Anti-Bcl10 antibody [SPM520] (ab233989)
Key features and details
- Mouse monoclonal [SPM520] to Bcl10
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-Bcl10 antibody [SPM520]
See all Bcl10 primary antibodies -
Description
Mouse monoclonal [SPM520] to Bcl10 -
Host species
Mouse -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant full length protein corresponding to Bcl10.
Database link: O95999 -
Epitope
Amino acids 122-168 (CEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFST) -
Positive control
- IHC-P: Human tonsil tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.05% Sodium azide
Constituents: PBS, 0.05% BSA -
Concentration information loading...
-
Purity
Protein A/G purified -
Purification notes
Ab purified from Bioreactor Concentrate by Protein A/G. -
Clonality
Monoclonal -
Clone number
SPM520 -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Associated products
-
Alternative Versions
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab233989 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Primary incubation for 30 minutes at room temperature. |
Notes |
---|
IHC-P
Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. Primary incubation for 30 minutes at room temperature. |
Target
-
Function
Promotes apoptosis, pro-caspase-9 maturation and activation of NF-kappa-B via NIK and IKK. May be an adapter protein between upstream TNFR1-TRADD-RIP complex and the downstream NIK-IKK-IKAP complex. Is a substrate for MALT1. -
Tissue specificity
Ubiquitous. -
Involvement in disease
Note=A chromosomal aberration involving BCL10 is recurrent in low-grade mucosa-associated lymphoid tissue (MALT lymphoma). Translocation t(1;14)(p22;q32). Although the BCL10/IgH translocation leaves the coding region of BCL10 intact, frequent BCL10 mutations could be attributed to the Ig somatic hypermutation mechanism resulting in nucleotide transitions.
Note=Defects in BCL10 are involved in various types of cancer. -
Sequence similarities
Contains 1 CARD domain. -
Post-translational
modificationsPhosphorylated. Phosphorylation results in dissociation from TRAF2 and binding to BIRC2/c-IAP2. -
Cellular localization
Cytoplasm > perinuclear region. Membrane raft. Appears to have a perinuclear, compact and filamentous pattern of expression. Also found in the nucleus of several types of tumor cells. Colocalized with DPP4 in membrane rafts. - Information by UniProt
-
Database links
- Entrez Gene: 8915 Human
- Entrez Gene: 12042 Mouse
- Entrez Gene: 83477 Rat
- Omim: 603517 Human
- SwissProt: O95999 Human
- SwissProt: Q9Z0H7 Mouse
- SwissProt: Q9QYN5 Rat
- Unigene: 193516 Human
see all -
Alternative names
- AI132454 antibody
- B cell CLL/lymphoma 10 antibody
- B cell lymphoma/leukemia10 antibody
see all
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab233989 has not yet been referenced specifically in any publications.