For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    bcl10-antibody-spm520-ab233989.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Apoptosis Intracellular Bcl2 Family
Share by email

Anti-Bcl10 antibody [SPM520] (ab233989)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Bcl10 antibody [SPM520] (ab233989)

    Key features and details

    • Mouse monoclonal [SPM520] to Bcl10
    • Suitable for: IHC-P
    • Reacts with: Human
    • Isotype: IgG1

    You may also be interested in

    Protein
    Product image
    Recombinant Human Bcl10 protein (ab124575)
    Secondary
    Product image
    Goat Anti-Mouse IgG H&L (HRP) (ab205719)

    View more associated products

    Overview

    • Product name

      Anti-Bcl10 antibody [SPM520]
      See all Bcl10 primary antibodies
    • Description

      Mouse monoclonal [SPM520] to Bcl10
    • Host species

      Mouse
    • Tested applications

      Suitable for: IHC-Pmore details
    • Species reactivity

      Reacts with: Human
      Predicted to work with: Mouse, Rat
    • Immunogen

      Recombinant full length protein corresponding to Bcl10.
      Database link: O95999

    • Epitope

      Amino acids 122-168 (CEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFST)
    • Positive control

      • IHC-P: Human tonsil tissue.
    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      Preservative: 0.05% Sodium azide
      Constituents: PBS, 0.05% BSA
    • Concentration information loading...
    • Purity

      Protein A/G purified
    • Purification notes

      Ab purified from Bioreactor Concentrate by Protein A/G.
    • Clonality

      Monoclonal
    • Clone number

      SPM520
    • Isotype

      IgG1
    • Light chain type

      kappa
    • Research areas

      • Cell Biology
      • Apoptosis
      • Intracellular
      • Bcl2 Family
      • Cell Biology
      • Apoptosis
      • Intracellular
      • Caspases etc
      • CARD Family
      • Signal Transduction
      • Signaling Pathway
      • Nuclear Signaling
      • NFkB Pathway
      • Cancer
      • Invasion/microenvironment
      • Apoptosis
      • Bcl 2 family
      • Cancer
      • Signal transduction
      • Nuclear signaling
      • NFkB pathway
      • Metabolism
      • Pathways and Processes
      • Metabolism processes
      • Apoptosis
      • Cancer
      • Cell Death
      • Apoptosis
      • Apoptosis Markers
      • Bcl 2 family
      • Cancer
      • Cell Death
      • Apoptosis
      • Metabolism

    Associated products

    • Alternative Versions

      • Anti-Bcl10 antibody [SPM520] - BSA and Azide free (ab212979)
    • Compatible Secondaries

      • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
      • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
    • Isotype control

      • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
    • Recombinant Protein

      • Recombinant Human Bcl10 protein (ab124575)
    • Related Products

      • Recombinant Human Bcl10 protein (ab124575)

    Applications

    Our Abpromise guarantee covers the use of ab233989 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

    Primary incubation for 30 minutes at room temperature.

    Target

    • Function

      Promotes apoptosis, pro-caspase-9 maturation and activation of NF-kappa-B via NIK and IKK. May be an adapter protein between upstream TNFR1-TRADD-RIP complex and the downstream NIK-IKK-IKAP complex. Is a substrate for MALT1.
    • Tissue specificity

      Ubiquitous.
    • Involvement in disease

      Note=A chromosomal aberration involving BCL10 is recurrent in low-grade mucosa-associated lymphoid tissue (MALT lymphoma). Translocation t(1;14)(p22;q32). Although the BCL10/IgH translocation leaves the coding region of BCL10 intact, frequent BCL10 mutations could be attributed to the Ig somatic hypermutation mechanism resulting in nucleotide transitions.
      Note=Defects in BCL10 are involved in various types of cancer.
    • Sequence similarities

      Contains 1 CARD domain.
    • Post-translational
      modifications

      Phosphorylated. Phosphorylation results in dissociation from TRAF2 and binding to BIRC2/c-IAP2.
    • Cellular localization

      Cytoplasm > perinuclear region. Membrane raft. Appears to have a perinuclear, compact and filamentous pattern of expression. Also found in the nucleus of several types of tumor cells. Colocalized with DPP4 in membrane rafts.
    • Target information above from: UniProt accession O95999 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 8915 Human
      • Entrez Gene: 12042 Mouse
      • Entrez Gene: 83477 Rat
      • Omim: 603517 Human
      • SwissProt: O95999 Human
      • SwissProt: Q9Z0H7 Mouse
      • SwissProt: Q9QYN5 Rat
      • Unigene: 193516 Human
      • Unigene: 239141 Mouse
      • Unigene: 13007 Rat
      see all
    • Alternative names

      • AI132454 antibody
      • B cell CLL/lymphoma 10 antibody
      • B cell lymphoma/leukemia10 antibody
      • B-cell CLL/lymphoma 10 antibody
      • B-cell leukemia/lymphoma 10 antibody
      • B-cell lymphoma/leukemia 10 antibody
      • Bcl 10 antibody
      • Bcl-10 antibody
      • Bcl10 antibody
      • BCL10_HUMAN antibody
      • c E10 antibody
      • c-E10 antibody
      • C81403 antibody
      • CARD containing apoptotic signaling protein antibody
      • CARD containing molecule enhancing NF kappa B antibody
      • CARD containing molecule enhancing NF kB antibody
      • CARD containing molecule enhancing NF-kB antibody
      • CARD containing molecule enhancing NFkB antibody
      • CARD containing proapoptotic protein antibody
      • CARD like apoptotic protein antibody
      • CARD-containing apoptotic signaling protein antibody
      • CARD-containing molecule enhancing NF-kappa-B antibody
      • CARD-containing proapoptotic protein antibody
      • CARD-like apoptotic protein antibody
      • CARMEN antibody
      • Caspase recruiting domain containing protein antibody
      • caspase-recruiting domain-containing protein antibody
      • cCARMEN antibody
      • cE 10 antibody
      • cE10 antibody
      • CED 3/ICH 1 prodomain homologous E10 like regulator antibody
      • CED-3/ICH-1 prodomain homologous E10-like regulator antibody
      • CED3/ICH1 prodomain homologous E10 like regulator antibody
      • Cellular E10 antibody
      • Cellular homolog of vCARMEN antibody
      • Cellular-E10 antibody
      • CIPER antibody
      • CLAP antibody
      • hCLAP antibody
      • Mammalian CARD containing adapter molecule E10 antibody
      • Mammalian CARD-containing adapter molecule E10 antibody
      • mE 10 antibody
      • mE10 antibody
      • R-RCD1 antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Bcl10 antibody [SPM520] (ab233989)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Bcl10 antibody [SPM520] (ab233989)

      Formalin-fixed, paraffin-embedded human tonsil tissue stained for Bcl10 using ab233989 at 1 μg/mL in immunohistochemical analysis.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab233989? Please let us know so that we can cite the reference in this datasheet.

    ab233989 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab233989.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.