Anti-Bcl10 antibody [SPM520] (ab233989)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Bcl10 antibody [SPM520]
See all Bcl10 primary antibodies -
Description
Mouse monoclonal [SPM520] to Bcl10 -
Host species
Mouse -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant full length protein corresponding to Bcl10.
Database link: O95999 -
Epitope
Amino acids 122-168 (CEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFST) -
Positive control
- IHC-P: Human tonsil tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: PBS, 0.05% BSA -
Concentration information loading... -
Purity
Protein A/G purified -
Purification notes
Ab purified from Bioreactor Concentrate by Protein A/G. -
Clonality
Monoclonal -
Clone number
SPM520 -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Associated products
-
Alternative Versions
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab233989 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. Primary incubation for 30 minutes at room temperature. |
Target
-
Function
Promotes apoptosis, pro-caspase-9 maturation and activation of NF-kappa-B via NIK and IKK. May be an adapter protein between upstream TNFR1-TRADD-RIP complex and the downstream NIK-IKK-IKAP complex. Is a substrate for MALT1. -
Tissue specificity
Ubiquitous. -
Involvement in disease
Note=A chromosomal aberration involving BCL10 is recurrent in low-grade mucosa-associated lymphoid tissue (MALT lymphoma). Translocation t(1;14)(p22;q32). Although the BCL10/IgH translocation leaves the coding region of BCL10 intact, frequent BCL10 mutations could be attributed to the Ig somatic hypermutation mechanism resulting in nucleotide transitions.
Note=Defects in BCL10 are involved in various types of cancer. -
Sequence similarities
Contains 1 CARD domain. -
Post-translational
modificationsPhosphorylated. Phosphorylation results in dissociation from TRAF2 and binding to BIRC2/c-IAP2. -
Cellular localization
Cytoplasm > perinuclear region. Membrane raft. Appears to have a perinuclear, compact and filamentous pattern of expression. Also found in the nucleus of several types of tumor cells. Colocalized with DPP4 in membrane rafts. - Information by UniProt
-
Database links
- Entrez Gene: 8915 Human
- Entrez Gene: 12042 Mouse
- Entrez Gene: 83477 Rat
- Omim: 603517 Human
- SwissProt: O95999 Human
- SwissProt: Q9Z0H7 Mouse
- SwissProt: Q9QYN5 Rat
- Unigene: 193516 Human
see all -
Alternative names
- AI132454 antibody
- B cell CLL/lymphoma 10 antibody
- B cell lymphoma/leukemia10 antibody
see all
Images
-
![Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Bcl10 antibody [SPM520] (ab233989)](https://www.abcam.com/ps/products/233/ab233989/Images/ab233989-308156-5.jpg)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Bcl10 antibody [SPM520] (ab233989)Formalin-fixed, paraffin-embedded human tonsil tissue stained for Bcl10 using ab233989 at 1 μg/mL in immunohistochemical analysis.
Datasheets and documents
References
ab233989 has not yet been referenced specifically in any publications.
