Overview

  • Product name

    Anti-Bcl10 antibody [SPM520] - BSA and Azide free
    See all Bcl10 primary antibodies
  • Description

    Mouse monoclonal [SPM520] to Bcl10 - BSA and Azide free
  • Host species

    Mouse
  • Tested applications

    Suitable for: ICC/IF, Flow Cyt, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Human Bcl10.
    Database link: O95999

  • Epitope

    Amino acids 122-168 (CEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFST)
  • Positive control

    • Human tonsil tissue; WEHI-231 or Ramos cells or lymphoma.

Properties

Applications

Our Abpromise guarantee covers the use of ab212979 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 2 µg/ml.
Flow Cyt Use 0.5-1µg for 106 cells.
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Primary incubation for 30 minutes at room temperature.

WB Use a concentration of 0.5 - 1 µg/ml.

Target

  • Function

    Promotes apoptosis, pro-caspase-9 maturation and activation of NF-kappa-B via NIK and IKK. May be an adapter protein between upstream TNFR1-TRADD-RIP complex and the downstream NIK-IKK-IKAP complex. Is a substrate for MALT1.
  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Note=A chromosomal aberration involving BCL10 is recurrent in low-grade mucosa-associated lymphoid tissue (MALT lymphoma). Translocation t(1;14)(p22;q32). Although the BCL10/IgH translocation leaves the coding region of BCL10 intact, frequent BCL10 mutations could be attributed to the Ig somatic hypermutation mechanism resulting in nucleotide transitions.
    Note=Defects in BCL10 are involved in various types of cancer.
  • Sequence similarities

    Contains 1 CARD domain.
  • Post-translational
    modifications

    Phosphorylated. Phosphorylation results in dissociation from TRAF2 and binding to BIRC2/c-IAP2.
  • Cellular localization

    Cytoplasm > perinuclear region. Membrane raft. Appears to have a perinuclear, compact and filamentous pattern of expression. Also found in the nucleus of several types of tumor cells. Colocalized with DPP4 in membrane rafts.
  • Information by UniProt
  • Database links

  • Alternative names

    • AI132454 antibody
    • B cell CLL/lymphoma 10 antibody
    • B cell lymphoma/leukemia10 antibody
    • B-cell CLL/lymphoma 10 antibody
    • B-cell leukemia/lymphoma 10 antibody
    • B-cell lymphoma/leukemia 10 antibody
    • Bcl 10 antibody
    • Bcl-10 antibody
    • Bcl10 antibody
    • BCL10_HUMAN antibody
    • c E10 antibody
    • c-E10 antibody
    • C81403 antibody
    • CARD containing apoptotic signaling protein antibody
    • CARD containing molecule enhancing NF kappa B antibody
    • CARD containing molecule enhancing NF kB antibody
    • CARD containing molecule enhancing NF-kB antibody
    • CARD containing molecule enhancing NFkB antibody
    • CARD containing proapoptotic protein antibody
    • CARD like apoptotic protein antibody
    • CARD-containing apoptotic signaling protein antibody
    • CARD-containing molecule enhancing NF-kappa-B antibody
    • CARD-containing proapoptotic protein antibody
    • CARD-like apoptotic protein antibody
    • CARMEN antibody
    • Caspase recruiting domain containing protein antibody
    • caspase-recruiting domain-containing protein antibody
    • cCARMEN antibody
    • cE 10 antibody
    • cE10 antibody
    • CED 3/ICH 1 prodomain homologous E10 like regulator antibody
    • CED-3/ICH-1 prodomain homologous E10-like regulator antibody
    • CED3/ICH1 prodomain homologous E10 like regulator antibody
    • Cellular E10 antibody
    • Cellular homolog of vCARMEN antibody
    • Cellular-E10 antibody
    • CIPER antibody
    • CLAP antibody
    • hCLAP antibody
    • Mammalian CARD containing adapter molecule E10 antibody
    • Mammalian CARD-containing adapter molecule E10 antibody
    • mE 10 antibody
    • mE10 antibody
    • R-RCD1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human tonsil tissue labeling Bcl10 with ab212979 at 1 μg/mL.

References

ab212979 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab212979.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up