Overview

  • Product name

    Anti-BCL2L10 antibody [8A2F9]
    See all BCL2L10 primary antibodies
  • Description

    Mouse monoclonal [8A2F9] to BCL2L10
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human BCL2L10 aa 31-186. (Expressed in E.coli).
    Sequence:

    PSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSP GPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQR LVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSC LLTTAF


    Database link: Q9HD36

  • Positive control

    • WB: BCL2L10 (aa 31-186)-hIgGFc transfected HEK-293 cell lysate; Human BCL2L10 (aa 31-186) recombinant protein. ICC/IF: HeLa cells. Flow Cyt: HeLa cells. IHC-P: Human lung cancer and cervical cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab233641 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 22 kDa.
IHC-P 1/200 - 1/1000.
Flow Cyt 1/200 - 1/400.
ICC/IF 1/200 - 1/1000.

Target

  • Function

    Promotes cell survival. Suppresses apoptosis induced by BAX but not BAK.
  • Tissue specificity

    Widely expressed in adult tissues. Preferentially expressed in lung, liver and kidney.
  • Sequence similarities

    Belongs to the Bcl-2 family.
  • Cellular localization

    Mitochondrion. Nucleus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Anti apoptotic protein NrH antibody
    • Anti-apoptotic protein NrH antibody
    • Apoptosis regulator Bcl B antibody
    • Apoptosis regulator Bcl-B antibody
    • B2L10_HUMAN antibody
    • BCL B antibody
    • Bcl-2-like protein 10 antibody
    • Bcl2 L 10 antibody
    • BCL2 like 10 (apoptosis facilitator) antibody
    • BCL2 like 10 protein antibody
    • Bcl2-L-10 antibody
    • Bcl2l10 antibody
    • BCLB antibody
    • Boo antibody
    • Diva antibody
    • MGC129810 antibody
    • MGC129811 antibody
    • Nrh antibody
    see all

Images

  • Anti-BCL2L10 antibody [8A2F9] (ab233641) at 1/500 dilution + Human BCL2L10 (aa 31-186) recombinant protein

    Predicted band size: 22 kDa



    Expected MW is 43.1 kDa.

  • All lanes : Anti-BCL2L10 antibody [8A2F9] (ab233641) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : BCL2L10 (aa 31-186)-hIgGFc transfected HEK-293 cell lysate

    Predicted band size: 22 kDa

  • HeLa  (human epithelial cell line from cervix adenocarcinoma) cells stained for BCL2L10 (green) using ab233641 at 1/200 dilution in ICC/IF.

    Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.

  • Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cell line labeling BCL2L10 with ab233641 at 1/200 dilution (green) compared with a negative control (red).

  • Paraffin-embedded human lung cancer tissue stained for BCL2L10 using ab233641 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human cervical cancer tissue stained for BCL2L10 using ab233641 at 1/200 dilution in immunohistochemical analysis.

References

ab233641 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233641.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up