Overview

  • Product name

  • Description

    Rabbit polyclonal to Bcl6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human Bcl6 aa 520-560 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    CNECDCRFSEEASLKRHTLQTHSDKPYKCDRCQASFRYKGN


    Database link: P41182

  • Positive control

    • Mouse brain lysate; human gastric carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203619 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 79 kDa.
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 if using a fluorescent secondary antibody)

Target

  • Function

    Transcriptional repressor which is required for germinal center formation and antibody affinity maturation. Probably plays an important role in lymphomagenesis.
  • Tissue specificity

    Expressed in germinal center T and B cells and in primary immature dendritic cells.
  • Involvement in disease

    Note=Chromosomal aberrations involving BCL6 may be a cause of B-cell non-Hodgkin lymphoma. Translocation t(3;14)(q27;q32); translocation t(3;22)(q27;q11) with immunoglobulin gene regions.
    Note=A chromosomal aberration involving BCL6 may be a cause of a form of B-cell leukemia. Translocation t(3;11)(q27;q23) with POU2AF1/OBF1.
    Note=A chromosomal aberration involving BCL6 may be a cause of lymphoma. Translocation t(3;4)(q27;p11) with ARHH/TTF.
  • Sequence similarities

    Contains 1 BTB (POZ) domain.
    Contains 6 C2H2-type zinc fingers.
  • Domain

    The BTB domain mediates homodimerization. Its dimer interface mediates peptide binding such as to corepressors BCOR and NCOR2.
  • Post-translational
    modifications

    Phosphorylated by MAPK1 in response to antigen receptor activation. Phosphorylation induces its degradation by ubiquitin/proteasome pathway.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • B cell CLL/lymphoma 6 antibody
    • B cell lymphoma 6 protein antibody
    • B-cell lymphoma 5 protein antibody
    • B-cell lymphoma 6 protein antibody
    • BCL 5 antibody
    • Bcl 6 antibody
    • BCL-5 antibody
    • BCL-6 antibody
    • BCL5 antibody
    • BCL6 antibody
    • BCL6_HUMAN antibody
    • BCL6A antibody
    • cys his2 zinc finger transcription factor antibody
    • cys-his2 zinc finger transcription factor antibody
    • LAZ 3 antibody
    • LAZ 3 protein antibody
    • LAZ3 antibody
    • Lymphoma Associated Zinc Finger Gene On Chromosome 3 (LAZ3) antibody
    • Lymphoma associated zinc finger gene on chromosome 3 antibody
    • Protein LAZ-3 antibody
    • ZBTB 27 antibody
    • ZBTB27 antibody
    • Zinc finger and BTB domain containing protein 27 antibody
    • Zinc finger and BTB domain-containing protein 27 (ZBTB27) antibody
    • Zinc finger and BTB domain-containing protein 27 antibody
    • Zinc Finger Protein 51 (ZNF51) antibody
    • Zinc finger protein 51 antibody
    • zinc finger transcription factor BCL6S antibody
    • ZNF 51 antibody
    • ZNF51 antibody
    see all

Images

  • Anti-Bcl6 antibody (ab203619) at 1/200 dilution + mouse brain lysate

    Secondary
    Goat anti-rabbit IgG H+L conjugated HRP at 1/5000 dilution

    Predicted band size: 79 kDa

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded human gastric carcinoma tissue labeling Bcl6 with ab203619 at 1/200, followed by conjugation to the secondary antibody and DAB staining.

References

ab203619 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203619.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up