Overview

  • Product name

  • Description

    Rabbit polyclonal to BCL6B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 432-481 (VRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP ) of Human BCL6B (NP_862827).

  • Positive control

    • HepG2 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab87228 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance

    BCL6B acts as a sequence-specific transcriptional repressor in association with BCL6. It may function in a narrow stage or be related to some events in the early B-cell development.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • B cell CLL/lymphoma 6, member B (zinc finger protein) antibody
    • B-cell CLL/lymphoma 6, member B (zinc finger protein) antibody
    • BAZF antibody
    • Bcl6 associated zinc finger protein antibody
    • Bcl6-associated zinc finger protein antibody
    • BCL6B antibody
    • ZBTB28 antibody
    • Zinc finger protein 62 antibody
    • ZNF62 antibody
    see all

Images

  • Anti-BCL6B antibody (ab87228) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 52 kDa
    Observed band size: 52 kDa



    12% gel

References

This product has been referenced in:

  • Xu L  et al. Epigenetic inactivation of BCL6B, a novel functional tumour suppressor for gastric cancer, is associated with poor survival. Gut 61:977-85 (2012). Read more (PubMed: 21917650) »
See 1 Publication for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Question
Answer

Thanks for letting us know. You should receive order XXXXX for ab87228 today (XX/XX/XXXX).
Please respond if you have any other questions or concerns.

Read More

Question
Answer

Thank you for contacting us.
With the upcoming holiday, I wanted to make sure someone would be available to receive the free of charge replacement tomorrow, Wednesday the 21st, for ab87228. If not, I can set the order to ship Monday the 26th for deliver Tuesday the 27th. Our deadline for shipping is 8:00PM EST, so if I do not hear back from you by then I will set the order to ship Monday the 26th.
Your order number will be XXXXX
I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.
Free Rabbit monoclonal antibody with any purchase of a primary antibody, while stocks last! Quote “RABMAB-XBSMG” in your next primary antibody order. For more information, visit the following link: https://www.abcam.com/index.html?pageconfig=resource&rid=15447

Read More

Answer

Thank you for contacting Abcam.
I'm sorry the vial you received for ab87228 was damaged upon arrival. Is there a shortage of the solution or no solution left in the vial? If so, I am happy to send you a free of charge replacement. In the case that you do elect for a free replacement, could you reply with the order number associated with ab87228?
I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.
Free Rabbit monoclonal antibody with any purchase of a primary antibody, while stocks last! Quote “RABMAB-XBSMG” in your next primary antibody order. For more information, visit the following link: https://www.abcam.com/index.html?pageconfig=resource&rid=15447

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up