Overview

  • Product name

    Anti-BCL9L antibody [3B9C1]
    See all BCL9L primary antibodies
  • Description

    Mouse monoclonal [3B9C1] to BCL9L
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human BCL9L aa 606-751. Expressed in E.coli.
    Sequence:

    NQIQRVPGFGGMQSMPMEVPMNAMQRPVRPGMGWTEDLPPMGGPSNFAQN TMPYPGGQGEAERFMTPRVREELLRHQLLEKRSMGMQRPLGMAGSGMGQS MEMERMMQAHRQMDPAMFPGQMAGGEGLAGTPMGMEFGGGRGLLSP


    Database link: Q86UU0

  • Positive control

    • WB: Human BCL9L (AA: 606-751) recombinant protein; BCL9L (AA: 606-751)-hIgGFc transfected HEK-293 cell lysate. IHC-P: Human cervical cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Monoclonal
  • Clone number

    3B9C1
  • Isotype

    IgG1

Applications

Our Abpromise guarantee covers the use of ab233736 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000.

Target

  • Function

    Transcriptional regulator that acts as an activator. Promotes beta-catenin transcriptional activity. Plays a role in tumorigenesis. Enhances the neoplastic transforming activity of CTNNB1.
  • Tissue specificity

    Expressed in breast, ductal and invasive ductal carcinomas of the breast, sporadic colorectal adenomas and carcinomas (at protein level). Expressed in fetal brain. Expressed in lung, amygdala, eye, prostate, pancreatic and prostate cancers, head and neck tumors and embryonal tumor.
  • Sequence similarities

    Belongs to the BCL9 family.
  • Domain

    Tne C-terminal domain is important for its transactivation activity.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • B-cell CLL antibody
    • B-cell CLL/lymphoma 9-like protein antibody
    • B-cell lymphoma 9-like protein antibody
    • B9L antibody
    • BCL9-2 antibody
    • BCL9-like protein antibody
    • BCL9-related beta-catenin-binding protein antibody
    • Bcl9l antibody
    • BCL9L_HUMAN antibody
    • DLNB11 antibody
    • Nuclear co factor of beta catenin signalling antibody
    • Protein BCL9-2 antibody
    see all

Images

  • Paraffin-embedded human cervical cancer tissue stained for BCL9L using ab233736 at 1/200 dilution in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-BCL9L antibody [3B9C1] (ab233736) at 1/500 dilution

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate.
    Lane 2 : BCL9L (AA: 606-751)-hIgGFc transfected HEK-293 cell lysate.
  • Anti-BCL9L antibody [3B9C1] (ab233736) at 1/500 dilution + Human BCL9L (AA: 606-751) recombinant protein.


    Expected MW is 41.9 kDa.

References

ab233736 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233736.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up