Anti-BCMO1 antibody (ab199272)
Key features and details
- Rabbit polyclonal to BCMO1
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-BCMO1 antibody -
Description
Rabbit polyclonal to BCMO1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human BCMO1 aa 1-203. (BC126212).
Sequence:MDIIFGRNRKEQLEPVRAKVTGKIPAWLQGTLLRNGPGMHTVGESRYNHW FDGLALLHSFTIRDGEVYYRSKYLRSDTYNTNIEANRIVVSEFGTMAYPD PCKNIFSKAFSYLSHTIPDFTDNCLINIMKCGEDFYATSETNYIRKINPQ TLETLEKVDYRKYVAVNLATSHPHYDEAGNVLNMGTSIVEKGKTKYVIFK IPA
Database link: Q9HAY6 -
Positive control
- Human liver tissue lysate; Human fetal colon tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:Reconstitute in 200 µl sterile water. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab199272 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/200 - 1/1000. Predicted molecular weight: 62 kDa. | |
IHC-P | 1/100 - 1/500. |
Target
-
Function
Symmetrically cleaves beta-carotene into two molecules of retinal. The reaction proceeds in three stages, epoxidation of the 15,15'-double bond, hydration of the double bond leading to ring opening, and oxidative cleavage of the diol formed. -
Tissue specificity
Highly expressed in retinal pigment epithelium. Also expressed in kidney, testis, liver, brain, small intestine and colon. -
Pathway
Cofactor metabolism; retinol metabolism. -
Involvement in disease
Defects in BCMO1 are the cause of autosomal dominant hypercarotenemia and vitamin A deficiency (ADHVAD) [MIM:115300]. Vitamin A is essential for normal embryonic development as well as normal physiological functions in children and adults. Hypercarotenemia is characterized by an excess carotene in the serum, but unlike excess vitamin A, carotene is non-toxic. So far, only a few cases of excess vitamin A have been reported. Individuals were thought to be vitamin A deficient due to an impairment in the conversion of carotenoids to retinal in the intestine. -
Sequence similarities
Belongs to the carotenoid oxygenase family. - Information by UniProt
-
Database links
- Entrez Gene: 53630 Human
- Entrez Gene: 63857 Mouse
- Entrez Gene: 114106 Rat
- Omim: 605748 Human
- SwissProt: Q9HAY6 Human
- SwissProt: Q9JJS6 Mouse
- SwissProt: Q91XT5 Rat
- Unigene: 212172 Human
see all -
Alternative names
- BCDO antibody
- BCDO1 antibody
- BCDO1_HUMAN antibody
see all
Images
-
Anti-BCMO1 antibody (ab199272) at 1/500 dilution + Human liver tissue lysate
Predicted band size: 62 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-BCMO1 antibody (ab199272)
Immunohistochemical analysis of formalin-fixed paraffin-embedded Human fetal colon tissue labeling BCMO1 with ab199272 at 1/100 dilution.
Protocols
References (0)
ab199272 has not yet been referenced specifically in any publications.