Anti-BCMO1 antibody (ab199272)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-BCMO1 antibody
See all BCMO1 primary antibodies -
Description
Rabbit polyclonal to BCMO1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human BCMO1 aa 1-203. (BC126212).
Sequence:MDIIFGRNRKEQLEPVRAKVTGKIPAWLQGTLLRNGPGMHTVGESRYNHW FDGLALLHSFTIRDGEVYYRSKYLRSDTYNTNIEANRIVVSEFGTMAYPD PCKNIFSKAFSYLSHTIPDFTDNCLINIMKCGEDFYATSETNYIRKINPQ TLETLEKVDYRKYVAVNLATSHPHYDEAGNVLNMGTSIVEKGKTKYVIFK IPA
Database link: Q9HAY6 -
Positive control
- Human liver tissue lysate; Human fetal colon tissue.
Properties
-
Form
Lyophilised:Reconstitute in 200 µl sterile water. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab199272 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/200 - 1/1000. Predicted molecular weight: 62 kDa. | |
| IHC-P | 1/100 - 1/500. |
Target
-
Function
Symmetrically cleaves beta-carotene into two molecules of retinal. The reaction proceeds in three stages, epoxidation of the 15,15'-double bond, hydration of the double bond leading to ring opening, and oxidative cleavage of the diol formed. -
Tissue specificity
Highly expressed in retinal pigment epithelium. Also expressed in kidney, testis, liver, brain, small intestine and colon. -
Pathway
Cofactor metabolism; retinol metabolism. -
Involvement in disease
Defects in BCMO1 are the cause of autosomal dominant hypercarotenemia and vitamin A deficiency (ADHVAD) [MIM:115300]. Vitamin A is essential for normal embryonic development as well as normal physiological functions in children and adults. Hypercarotenemia is characterized by an excess carotene in the serum, but unlike excess vitamin A, carotene is non-toxic. So far, only a few cases of excess vitamin A have been reported. Individuals were thought to be vitamin A deficient due to an impairment in the conversion of carotenoids to retinal in the intestine. -
Sequence similarities
Belongs to the carotenoid oxygenase family. - Information by UniProt
-
Database links
- Entrez Gene: 53630 Human
- Entrez Gene: 63857 Mouse
- Entrez Gene: 114106 Rat
- Omim: 605748 Human
- SwissProt: Q9HAY6 Human
- SwissProt: Q9JJS6 Mouse
- SwissProt: Q91XT5 Rat
- Unigene: 212172 Human
see all -
Alternative names
- BCDO antibody
- BCDO1 antibody
- BCDO1_HUMAN antibody
see all
Images
-
Western blot - Anti-BCMO1 antibody (ab199272)Anti-BCMO1 antibody (ab199272) at 1/500 dilution + Human liver tissue lysate
Predicted band size: 62 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-BCMO1 antibody (ab199272)Immunohistochemical analysis of formalin-fixed paraffin-embedded Human fetal colon tissue labeling BCMO1 with ab199272 at 1/100 dilution.
References
ab199272 has not yet been referenced specifically in any publications.
