Overview

  • Product name

    Anti-BCO2 antibody
  • Description

    Rabbit polyclonal to BCO2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human BCO2 aa 152-354. Isoform 5
    Sequence:

    DPCKNVFERFMSRFELPGKAAGFSYKVIRVPPEKVDLGETIHGVQVICSI ASTEKGKPSYYHSFGMTRNYIIFIEQPLKMNLWKIATSKIRGKAFSDGIS WEPQCNTRFHVVEKRTGQLLPGRYYSKPFVTFHQINAFEDQGCVIIDLCC QDNGRTLEVYQLQNLRKAGEGLDQVHNSAAKSFPRRFVLPLNVSLNAPEG DNL


    Database link: Q9BYV7-5

  • Positive control

    • Human muscle lysate; Human fetal stomach tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab199297 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Predicted molecular weight: 57 kDa.

Target

  • Function

    Asymmetrically cleaves beta-carotene at the 9',10' double bond resulting in the formation of beta-apo-10'-carotenal and beta-ionone. Besides beta-carotene, lycopene is also oxidatively cleaved. The apocarotenals formed by this enzyme may be the precursors for the biosynthesis of retinoic acid or exert unknown physiological effects.
  • Tissue specificity

    Highly expressed in retinal pigment epithelium. Also expressed in stomach, small intestine, liver, testis, kidney, adrenal gland, pancreas, heart, skeletal muscle and prostate (at protein level).
  • Sequence similarities

    Belongs to the carotenoid oxygenase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • B-diox-II antibody
    • BCDO2_HUMAN antibody
    • Bco2 antibody
    • Beta,beta-carotene 9',10'-oxygenase antibody
    • Beta-carotene dioxygenase 2 antibody
    see all

Images

  • Anti-BCO2 antibody (ab199297) at 1/500 dilution + human muscle lysate

    Predicted band size: 57 kDa

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human fetal stomach tissue labeling BCO2 using ab199297 at 1/100 dilution.

References

ab199297 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199297.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up