Overview

  • Product name
  • Description
    Rabbit polyclonal to BCORL1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human BCORL1 aa 1017-1114 (internal sequence).
    Sequence:

    HPKELILDVVPSSRRGSSTERPQLGSQVDLGRVKMEKVDGDVVFNLATCF RADGLPVAPQRGQAEVRAKAGQARVKQESVGVFACKNKWQPDDVTESL


    Database link: Q5H9F3

  • Positive control
    • ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221627 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100.

 

Target

  • Function
    Transcriptional corepressor. May specifically inhibit gene expression when recruited to promoter regions by sequence specific DNA-binding proteins such as BCL6. This repression may be mediated at least in part by histone deacetylase activities which can associate with this corepressor.
  • Tissue specificity
    Detected in testis and prostate. Detected at lower levels in peripheral blood leukocytes and spleen.
  • Sequence similarities
    Belongs to the BCOR family.
    Contains 3 ANK repeats.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Form
    There are 3 isoforms produced by alternative splicing.
  • Alternative names
    • BCL-6 corepressor-like protein 1 antibody
    • BCL6 co-repressor-like 1 antibody
    • BCL6 corepressor-like 1 antibody
    • BCoR-L1 antibody
    • BCoR-like protein 1 antibody
    • BCORL_HUMAN antibody
    • BCORL1 antibody
    • CXorf10 antibody
    • FLJ11362 antibody
    • FLJ11632 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for BCORL1 (green) using ab221627 at 4 µg/ml in ICC/IF. 

References

ab221627 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221627.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up