Overview

  • Product name

  • Description

    Rabbit polyclonal to BCS1L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human BCS1L aa 33-240.
    Sequence:

    RKGVQLGLVAFRRHYMITLEVPARDRSYAWLLSWLTRHSTRTQHLSVETS YLQHESGRISTKFEFVPSPGNHFIWYRGKWIRVERSREMQMIDLQTGTPW ESVTFTALGTDRKVFFNILEEARELALQQEEGKTVMYTAVGSEWRPFGYP RRRRPLNSVVLQQGLADRIVRDVQEFIDNPKWYTDRGIPYRRGYLLYGPP GCGKSSFI


    Database link: Q9Y276

  • Positive control

    • WB: Mouse kidney, liver and brain lysates; A549, HEK-293T and HeLa whole cell lysates. IHC-P: Human glioma cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230479 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 48 kDa.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    BCS1L (BCS1-like) is a chaperone necessary for the assembly of mitochondrial respiratory chain complex III. The protein does not contain a mitochondrial targeting sequence but experimental studies confirm that it is imported into mitochondria. Mutations in this gene are associated with mitochondrial complex III deficiency and the GRACILE syndrome. Two alternatively spliced transcripts encoding the same protein have been described.
  • Cellular localization

    Mitochondrial. Mitochondrion inner membrane. Single-pass membrane protein.
  • Database links

  • Alternative names

    • BCS 1 antibody
    • BCS 1L antibody
    • BCS antibody
    • BCS1 (yeast homolog) like antibody
    • BCS1 antibody
    • BCS1 like (S. cerevisiae) antibody
    • BCS1 like antibody
    • BCS1 like protein antibody
    • Bjornstad syndrome (pili torti and deafness) antibody
    • BJS antibody
    • FLNMS antibody
    • GRACILE antibody
    • h BCS antibody
    • H BCS1 antibody
    • Hs.6719 antibody
    • Mitochondrial chaperone BCS1 antibody
    • Mitochondrial complex III assembly antibody
    • PTD antibody
    see all

Images

  • All lanes : Anti-BCS1L antibody (ab230479) at 1/1000 dilution

    Lane 1 : Mouse kidney lysate
    Lane 2 : Mouse liver lysate
    Lane 3 : Mouse brain lysate
    Lane 4 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 5 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 6 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 48 kDa

  • Paraffin-embedded human glioma cancer tissue stained for BCS1L using ab230479 at 1/100 dilution in immunohistochemical analysis.

References

ab230479 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230479.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up