Overview

  • Product name

  • Description

    Rabbit polyclonal to BDH1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ELISA, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human BDH1 aa 47-343.
    Sequence:

    ASAAEPVGSKAVLVTGCDSGFGFSLAKHLHSKGFLVFAGCLMKDKGHDGV KELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAG ISTFGEVEFTSLETYKQVAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSM LGRMANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATS LYSPESIQAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTS PVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR


    Database link: Q02338

  • Positive control

    • WB: HepG2 whole cell lysate, mouse liver, kidney and brain tissue lysates. IHC-P: Mouse liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab193156 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ELISA Use at an assay dependent concentration.
WB 1/500 - 1/2000. Predicted molecular weight: 38 kDa.

Target

Images

  • All lanes : Anti-BDH1 antibody (ab193156) at 2.4 µg/ml

    Lane 1 : HepG2 whole cell lysate
    Lane 2 : Mouse liver tissue lysate
    Lane 3 : Mouse kidney tissue lysate
    Lane 4 : Mouse brain tissue lysate

    Secondary
    All lanes : Polyclonal goat anti-rabbit at 1/10000 dilution

    Predicted band size: 38 kDa
    Observed band size: 38 kDa

  • Immunohistochemical analysis of paraffin-embedded mouse liver tissue labeling BDH1 with ab193156 at 1/50 dilution.

References

ab193156 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193156.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up