Overview

  • Product name

  • Description

    Rabbit polyclonal to BDH1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human BDH1 aa 1-343. Two N-terminal tags, Expressed in E.coli.
    Sequence:

    MLATRLSRPLSRLPGKTLSACDRENGARRPLLLGSTSFIPIGRRTYASAA EPVGSKAVLVTGCDSGFGFSLAKHLHSKGFLVFAGCLMKDKGHDGVKELD SLNSDRLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTF GEVEFTSLETYKQVAEVNLWGTVRMTKSFLPLIRRAKGRVVNISSMLGRM ANPARSPYCITKFGVEAFSDCLRYEMYPLGVKVSVVEPGNFIAATSLYSP ESIQAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVID AVTHALTATTPYTRYHPMDYYWWLRMQIMTHLPGAISDMIYIR


    Database link: Q02338

  • Positive control

    • IHC-P: Human liver tissue. WB: Recombinant human BDH1 protein; Pig heart lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab231940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Sequence similarities

    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3 hydroxybutyrate dehydrogenase (heart, mitochondrial) antibody
    • 3-hydroxybutyrate dehydrogenase antibody
    • BDH antibody
    • BDH_HUMAN antibody
    • BDH1 antibody
    • D beta hydroxybutyrate dehydrogenase, mitochondrial antibody
    • D-beta-hydroxybutyrate dehydrogenase antibody
    • mitochondrial antibody
    see all

Images

  • Anti-BDH1 antibody (ab231940) at 2 µg/ml + Pig heart lysate.

    Developed using the ECL technique.
  • Anti-BDH1 antibody (ab231940) at 2 µg/ml + Recombinant human BDH1 protein.

    Developed using the ECL technique.
  • Formalin-fixed, paraffin-embedded human liver tissue stained for BDH1 using ab231940 at 20 µg/mL in immunohistochemical analysis. DAB staining.

References

ab231940 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up