Overview

  • Product name

  • Description

    Rabbit polyclonal to BDNF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human BDNF aa 20-149.
    Sequence:

    PMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEE LLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDA ANMSMRVRRHSDPARRGELSVCDSISEWVT


    Database link: P23560

  • Positive control

    • ICC/F: U-2 OS cells. WB: U-138 MG whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab220679 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 27 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.
  • Tissue specificity

    Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.
  • Involvement in disease

    Bulimia nervosa 2
    Congenital central hypoventilation syndrome
  • Sequence similarities

    Belongs to the NGF-beta family.
  • Post-translational
    modifications

    The propeptide is N-glycosylated and glycosulfated.
    Converted into mature BDNF by plasmin (PLG).
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Abrineurin antibody
    • ANON2 antibody
    • BDNF antibody
    • BDNF_HUMAN antibody
    • Brain Derived Neurotrophic Factor antibody
    • Brain-derived neurotrophic factor antibody
    • BULN2 antibody
    • MGC34632 antibody
    • Neurotrophin antibody
    see all

Images

  • Anti-BDNF antibody (ab220679) at 0.4 µg/ml + U-138 MG (human brain glioblastoma cell line) whole cell lysate

    Predicted band size: 27 kDa

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling BDNF with ab220679 at 4 µg/mL (green).

References

ab220679 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220679.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up