Anti-BDNF antibody (ab222060)
Key features and details
- Rabbit polyclonal to BDNF
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-BDNF antibody
See all BDNF primary antibodies -
Description
Rabbit polyclonal to BDNF -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Horse, Cow, Cat, Dog, Pig, Chimpanzee, Rhesus monkey -
Immunogen
Recombinant fragment corresponding to Human BDNF aa 154-223.
Sequence:KTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRH WNSQCRTTQSYVRALTMDSK
Database link: P23560 -
Positive control
- ICC/IF: U-2 OS cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Immunizing Peptide (Blocking)
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab222060 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. -
Tissue specificity
Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta. -
Involvement in disease
Bulimia nervosa 2
Congenital central hypoventilation syndrome -
Sequence similarities
Belongs to the NGF-beta family. -
Post-translational
modificationsThe propeptide is N-glycosylated and glycosulfated.
Converted into mature BDNF by plasmin (PLG). -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 493690 Cat
- Entrez Gene: 503511 Chimpanzee
- Entrez Gene: 617701 Cow
- Entrez Gene: 403461 Dog
- Entrez Gene: 100009689 Horse
- Entrez Gene: 627 Human
- Entrez Gene: 12064 Mouse
- Entrez Gene: 397495 Pig
see all -
Alternative names
- Abrineurin antibody
- ANON2 antibody
- BDNF antibody
see all
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab222060 has not yet been referenced specifically in any publications.