Anti-BDNF antibody (ab222060)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-BDNF antibody
See all BDNF primary antibodies -
Description
Rabbit polyclonal to BDNF -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Horse, Cow, Cat, Dog, Pig, Chimpanzee, Rhesus monkey
-
Immunogen
Recombinant fragment corresponding to Human BDNF aa 154-223.
Sequence:KTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRH WNSQCRTTQSYVRALTMDSK
Database link: P23560 -
Positive control
- ICC/IF: U-2 OS cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Immunizing Peptide (Blocking)
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab222060 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. -
Tissue specificity
Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta. -
Involvement in disease
Bulimia nervosa 2
Congenital central hypoventilation syndrome -
Sequence similarities
Belongs to the NGF-beta family. -
Post-translational
modificationsThe propeptide is N-glycosylated and glycosulfated.
Converted into mature BDNF by plasmin (PLG). -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 493690 Cat
- Entrez Gene: 503511 Chimpanzee
- Entrez Gene: 617701 Cow
- Entrez Gene: 403461 Dog
- Entrez Gene: 100009689 Horse
- Entrez Gene: 627 Human
- Entrez Gene: 12064 Mouse
- Entrez Gene: 397495 Pig
see all -
Alternative names
- Abrineurin antibody
- ANON2 antibody
- BDNF antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-BDNF antibody (ab222060)PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for BDNF (green) using ab222060 at 4 µg/ml in ICC/IF.
Datasheets and documents
References
ab222060 has not yet been referenced specifically in any publications.
