Overview

  • Product name

    Anti-BDNF antibody (Biotin)
    See all BDNF primary antibodies
  • Description

    Rabbit polyclonal to BDNF (Biotin)
  • Host species

    Rabbit
  • Conjugation

    Biotin
  • Tested applications

    Suitable for: WB, Sandwich ELISAmore details
  • Species reactivity


    Predicted to work with: Mouse, Rat, Horse, Cow, Cat, Dog, Human, Pig, Chimpanzee, Rhesus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human BDNF aa 129-247. Full-length mature chainlacking the signal peptide and propeptide. Produced in E.coli.
    Sequence:

    MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQL KQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIG WRFIRIDTSCVCTLTIKRGR


    Database link: P23560

  • Positive control

    • WB: Recombinant human BDNF protein. sELISA: Recombinant human BDNF protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab245864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 27 kDa.
Sandwich ELISA Use a concentration of 0.25 - 1 µg/ml.

Target

Images

  • To detect human BDNF by Western Blot analysis ab245864 can be used at a concentration of 0.1 - 0.2 µg/ml.

    Used in conjunction with compatible secondary reagents the detection limit for recombinant human BDNF is 1.5 - 3.0 ng/lane, under either reducing or non-reducing conditions.

    Lanes 1-11: 250, 125, 62.5, 31.25, 15.625, 7.8, 3.9, 1.95, 0.975, 0.4875 and 0.24 ng recombinant human BDNF, respectively.

    Non-reducing conditions.

  • To detect humanBDNF by sandwich ELISA (using 100 μl/well antibody solution) a concentration of 0.25 – 1.0 μg/ml of ab245864 is required.

    This biotinylated polyclonal antibody, in conjunction with a capture antibody, allows the detection of at least 0.2 – 0.4 ng/well of recombinant human BDNF.

References

ab245864 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab245864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up