Overview

  • Product name

  • Description

    Rabbit polyclonal to Beclin 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Chicken, Cow, Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Beclin 1 aa 1-273. Expressed in E.coli. N-terminal tags.
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-MEGSKTSNNSTMQ VSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETN SGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLS RRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYK RCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLE KVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDK LKKTNVFNAT


    Database link: Q14457

  • Positive control

    • WB: A431, HeLa and MCF7 cell lysate; Porcine brain tissue. Recombinant human Beclin 1 protein. IHC-P: Human cerebrum, stomach and pancreas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab231341 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.

Target

Images

  • DAB stained, formalin-fixed paraffin-embedded human pancreas tissue stained for Beclin 1 using ab231341 at 30 µg/mL in immunohistochemical analysis. 

  • All lanes : Anti-Beclin 1 antibody (ab231341) at 2 µg/ml

    Lane 1 : A431 (Human epidermoid carcinoma cell line) cell lysate
    Lane 2 : HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 3 : Porcine brain tissue
  • DAB stained, formalin-fixed paraffin-embedded human stomach tissue stained for Beclin 1 using ab231341 at 30 µg/mL in immunohistochemical analysis.

  • DAB stained, formalin-fixed paraffin-embedded human cerebrum tissue stained for Beclin 1 using ab231341 at 30 µg/mL in immunohistochemical analysis.

  • Anti-Beclin 1 antibody (ab231341) at 2 µg/ml + Recombinant human Beclin 1 protein

References

ab231341 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231341.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up