Overview

  • Product name

    Anti-Bet1 antibody
  • Description

    Rabbit polyclonal to Bet1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human Bet1 aa 1-83.
    Sequence:

    MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLS IEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMG


    Database link: O15155

  • Positive control

    • WB: K562 cell lysate; Rat brain tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab223038 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 14 kDa (predicted molecular weight: 10,14 kDa).

Target

  • Relevance

    The protein encoded by this gene is a homolog of yeast Bet1 protein which is a golgi-associated protein that participates in vesicular transport from the endoplasmic reticulum (ER) to the Golgi apparatus. Studies with the rat homolog suggest that it is localized in the vesicular structures, and may be involved in the docking process of ER-derived vesicles with the cis-Golgi membrane.
  • Cellular localization

    Cell Membrane
  • Database links

  • Alternative names

    • BET1 homolog antibody
    • Bet1p homolog antibody
    • Golgi vesicular membrane trafficking protein p18 antibody
    • hbet1 antibody

Images

  • All lanes : Anti-Bet1 antibody (ab223038) at 1/500 dilution

    Lane 1 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 2 : Rat brain tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 10,14 kDa
    Observed band size: 14 kDa
    why is the actual band size different from the predicted?

References

ab223038 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223038.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up