Overview

  • Product name

  • Description

    Mouse polyclonal to BET3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken
  • Immunogen

    Full length protein corresponding to Human BET3 aa 1-180.
    Sequence:

    MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFN IGVRLIEDFLARSNVGRCHDFRETADVIAKVAFKMYLGITPSITNWSPAG DEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALEMVQMAVEAKF VQDTLKGDGVTEIRMRFIRRIEDNLPAGEE


    Database link: NP_055223.1

  • Positive control

    • BET3 transfected 293T cell lysate.
  • General notes

    Previously labelled as TRAPPC3.

Properties

Applications

Our Abpromise guarantee covers the use of ab168999 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 20 kDa.

Target

Images

  • All lanes : Anti-BET3 antibody (ab168999) at 1 µg/ml

    Lane 1 : TRAPPC3 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 20 kDa

References

ab168999 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168999.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up