Anti-beta 2 Defensin/BD-2 antibody [B 235-I] (ab14426)

Overview

  • Product name

    Anti-beta 2 Defensin/BD-2 antibody [B 235-I]
    See all beta 2 Defensin/BD-2 primary antibodies
  • Description

    Mouse monoclonal [B 235-I] to beta 2 Defensin/BD-2
  • Host species

    Mouse
  • Specificity

    ab14426 recognises synthetic beta 2 Defensin/BD-2.

  • Tested applications

    Suitable for: ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Macaque monkey
  • Immunogen

    Synthetic peptide corresponding to Human beta 2 Defensin/BD-2 aa 4-41.
    Sequence:

    DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP


    (Peptide available as ab49529)

  • General notes

    Previously labelled as beta 2 Defensin.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.40
    Constituent: 0.605% Tris
  • Concentration information loading...
  • Purity

    Protein L purified
  • Purification notes

    Cell culture supernatant, protein L purified.
  • Clonality

    Monoclonal
  • Clone number

    B 235-I
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab14426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent dilution.

Target

  • Function

    Has antibacterial activity.
  • Tissue specificity

    Expressed in the skin and respiratory tract.
  • Sequence similarities

    Belongs to the beta-defensin family. LAP/TAP subfamily.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • BD 2 antibody
    • BD-2 antibody
    • BD2 antibody
    • beta 2 antibody
    • beta 2 Defensin antibody
    • Beta defensin 2 antibody
    • Beta defensin 4B antibody
    • Beta-defensin 2 antibody
    • Beta-defensin 4A antibody
    • DEF B2 antibody
    • DEF B4 antibody
    • DEFB 102 antibody
    • DEFB 2 antibody
    • DEFB 4 antibody
    • DEFB102 antibody
    • DEFB2 antibody
    • DEFB2, formerly antibody
    • DEFB4 antibody
    • DEFB4, formerly antibody
    • DEFB4B antibody
    • DEFB4P antibody
    • Defensin antibody
    • Defensin beta 2 antibody
    • Defensin, beta 4 antibody
    • Defensin, beta 4, pseudogene antibody
    • Defensin, beta 4A antibody
    • Defensin, beta 4B antibody
    • Defensin, beta, 2, formerly antibody
    • Defensin, beta, 4, formerly antibody
    • DFB4A_HUMAN antibody
    • HBD 2 antibody
    • hBD-2 antibody
    • HBD2 antibody
    • mBD-2 antibody
    • SAP 1 antibody
    • SAP1 antibody
    • Skin antimicrobial peptide 1 antibody
    • Skin-antimicrobial peptide 1 antibody
    see all

References

ab14426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-4 of 4 Abreviews or Q&A

Answer

Thank you for getting back to me with those details, it was very interesting. Unfortunately given that the source of the antisera have not been able to provide me with further details as to the synthesis of the immunising peptides it is difficult for me to comment on whether they have been raised against a correctly folded immunogen. If this was indeed the case then one might speculate that these antibodies only recognise the synthetic peptide and not the native form of the protein. However, checking back to past orders and this antibody is relatively popular and we have not received any complaints as such. I can but speculate that the absence of western or dot blot as applications on the datasheets is a reflection that these antibodies do not recognise their epitopes when immobilised on a membrane.

Read More

Answer

Thank you for your enquiry. Further to correspondence with the source of this antiserum I have been informed that the antiserum was raised against tricycle human ß-Defensin 2 antigen. Unfortunately they could not provide details of whether the antisera had been tested against the native protein or your protein standards. I have therefore not been able to find evidence that these sera have been tested against the native form of this protein. I would definitely be interested to know how these sera performed against the denatured forms of your standards.

Read More

Answer

Thank you for contacting me. Unfortunately I have not been able to obtain a satisfactory answer from the source of this antiserum as yet. I will be in touch as soon as I know more details about the synthesis of the immunising peptides. I appreciate your patience.

Read More

Answer

Thank you for your enquiry and your patience. The members of the defensin family are classified based on the position of the three íntramolecular disulfide bridges between cystein residues. They are classified as alpha- and beta-defensins. We have monoclonal antibodies specific for beta-defensin 1 and beta-defensin 2. They were generated against the respective synthetic peptides (with correct disulfide bridges). A sequence alignment of the two sequences gives no similarity beyond the position of the cystein residues. It is not likely that the antibodies cross react. However, this has not been tested experimentally. We hope you will find this information useful.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up