Overview

  • Product name

    Anti-beta 2 Microglobulin antibody
    See all beta 2 Microglobulin primary antibodies
  • Description

    Rabbit polyclonal to beta 2 Microglobulin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Dog
  • Immunogen

    Recombinant full length protein corresponding to Dog beta 2 Microglobulin aa 1-125. (Expressed in E.coli)
    Sequence:

    MAPRPALATAGFLALLLILLAACRLDAVQHPPKIQVYSRHPAENGKPNFL NCYVSGFHPPEIEIDLLKNGKEMKAEQTDLSFSKDWTFYLLVHTEFTPNE QDEFSCRVKHVTLSEPQIVKWDRDN


    Database link: E2RN10

  • Positive control

    • WB: Recombinant dog beta 2 Microglobulin protein; Human urine.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231225 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 14 kDa.

Target

  • Function

    Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system.
  • Involvement in disease

    Defects in B2M are the cause of hypercatabolic hypoproteinemia (HYCATHYP) [MIM:241600]. Affected individuals show marked reduction in serum concentrations of immunoglobulin and albumin, probably due to rapid degradation.
    Note=Beta-2-microglobulin may adopt the fibrillar configuration of amyloid in certain pathologic states. The capacity to assemble into amyloid fibrils is concentration dependent. Persistently high beta(2)-microglobulin serum levels lead to amyloidosis in patients on long-term hemodialysis.
  • Sequence similarities

    Belongs to the beta-2-microglobulin family.
    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    Glycation of Ile-21 is observed in long-term hemodialysis patients.
  • Cellular localization

    Secreted. Detected in serum and urine.
  • Information by UniProt
  • Database links

  • Alternative names

    • B2M antibody
    • B2MG_HUMAN antibody
    • Beta 2 microglobin antibody
    • Beta 2 microglobulin antibody
    • Beta 2 microglobulin precursor antibody
    • Beta chain of mhc class 1 proteins antibody
    • Beta chain of MHC class I molecules antibody
    • Beta-2-microglobulin form pI 5.3 antibody
    • CDABP0092 antibody
    • Hdcma22p antibody
    • IMD43 antibody
    see all

Images

  • Anti-beta 2 Microglobulin antibody (ab231225) at 2 µg/ml + Human urine

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 14 kDa

  • Anti-beta 2 Microglobulin antibody (ab231225) at 2 µg/ml + Recombinant dog beta 2 microglobulin

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 14 kDa

References

ab231225 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231225.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up