Overview

  • Product name

    Anti-beta 2 Microglobulin antibody [B2M/961]
    See all beta 2 Microglobulin primary antibodies
  • Description

    Mouse monoclonal [B2M/961] to beta 2 Microglobulin
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Non human primates
  • Immunogen

    Recombinant full length protein corresponding to Human beta 2 Microglobulin aa 1-119.
    Sequence:

    MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGF HPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYAC RVNHVTLSQPKIVKWDRDM


    Database link: P61769

  • Positive control

    • Human cervical carcinoma, melanoma, endometrial carcinoma, renal carcinoma, bladder carcinoma and colon carcinoma tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 99% PBS, 0.05% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    ab215889 was purified from Bioreactor Concentrate by Protein A/G.
  • Clonality

    Monoclonal
  • Clone number

    B2M/961
  • Isotype

    IgG2b
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab215889 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

(Primary incubation for 30 minutes at RT).

Target

  • Function

    Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system.
  • Involvement in disease

    Defects in B2M are the cause of hypercatabolic hypoproteinemia (HYCATHYP) [MIM:241600]. Affected individuals show marked reduction in serum concentrations of immunoglobulin and albumin, probably due to rapid degradation.
    Note=Beta-2-microglobulin may adopt the fibrillar configuration of amyloid in certain pathologic states. The capacity to assemble into amyloid fibrils is concentration dependent. Persistently high beta(2)-microglobulin serum levels lead to amyloidosis in patients on long-term hemodialysis.
  • Sequence similarities

    Belongs to the beta-2-microglobulin family.
    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    Glycation of Ile-21 is observed in long-term hemodialysis patients.
  • Cellular localization

    Secreted. Detected in serum and urine.
  • Information by UniProt
  • Database links

  • Alternative names

    • B2M antibody
    • B2MG_HUMAN antibody
    • Beta 2 microglobin antibody
    • Beta 2 microglobulin antibody
    • Beta 2 microglobulin precursor antibody
    • Beta chain of mhc class 1 proteins antibody
    • Beta chain of MHC class I molecules antibody
    • Beta-2-microglobulin form pI 5.3 antibody
    • CDABP0092 antibody
    • Hdcma22p antibody
    • IMD43 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human cervical carcinoma tissue labeling beta 2 Microglobulin with ab215889 at 1 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human melanoma tissue labeling beta 2 Microglobulin with ab215889 at 1 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human endometrial carcinoma tissue labeling beta 2 Microglobulin with ab215889 at 1 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human renal carcinoma tissue labeling beta 2 Microglobulin with ab215889 at 1 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human cervical carcinoma tissue labeling beta 2 Microglobulin with ab215889 at 1 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human bladder carcinoma tissue labeling beta 2 Microglobulin with ab215889 at 1 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon carcinoma tissue labeling beta 2 Microglobulin with ab215889 at 1µg/ml.

References

ab215889 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215889.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up