Overview

  • Product name

    Anti-beta B1 Crystallin antibody
  • Description

    Rabbit polyclonal to beta B1 Crystallin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Mouse beta Crystallin A3 aa 6-186. N -terminal GST-tag and HIs-tag. Expressed in E.coli.
    Sequence:

    KASATTAVNPGPDGKGKGAPSTGPAPAPGPTPVPASVPRPAAKVGDLPPG SYRLIVFEQENFQGRRVEFSGECLNLGDRGFDRVRSLIVVSGPWVAFEQS AFRGEMFVLEKGEYPRWDTWTSSYRSDRLMSFRPIRMDSQEHKICLFEGA NFKGNTMEIQEDDVPSLWVYGFCDRVGSITV


    Database link: Q9WVJ5

  • Positive control

    • WB: Recombinant mouse beta B1 Crystallin protein; Rat and mouse eye lysates. IHC-P: Mouse liver tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232799 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 28 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Crystallins are the dominant structural components of the vertebrate eye lens.
  • Involvement in disease

    Defects in CRYBB1 are the cause of cataract congenital nuclear autosomal recessive type 3 (CATCN3) [MIM:611544]. A congenital cataract affecting the central nucleus of the eye. Nuclear cataracts are often not highly visually significant. The density of the opacities varies greatly from fine dots to a dense, white and chalk-like, central cataract. The condition is usually bilateral. Nuclear cataracts are often combined with opacified cortical fibers encircling the nuclear opacity, which are referred to as cortical riders.
    Defects in CRYBB1 are a cause of cataract-microcornea syndrome (CAMIS) [MIM:116150]. An ocular disorder characterized by the association of congenital cataract and microcornea without any other systemic anomaly or dysmorphism. Clinical findings include a corneal diameter inferior to 10 mm in both meridians in an otherwise normal eye, and an inherited cataract, which is most often bilateral posterior polar with opacification in the lens periphery. The cataract progresses to form a total cataract after visual maturity has been achieved, requiring cataract extraction in the first to third decade of life. Microcornea-cataract syndrome can be associated with other rare ocular manifestations, including myopia, iris coloboma, sclerocornea and Peters anomaly. Transmission is in most cases autosomal dominant, but cases of autosomal recessive transmission have recently been described.
  • Sequence similarities

    Belongs to the beta/gamma-crystallin family.
    Contains 4 beta/gamma crystallin 'Greek key' domains.
  • Domain

    Has a two-domain beta-structure, folded into four very similar Greek key motifs.
  • Post-translational
    modifications

    Specific cleavages in the N-terminal arm occur during lens maturation and give rise to truncated forms, leading to impaired oligomerization and protein insolubilization.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta crystallin B1 antibody
    • Beta-B1 crystallin antibody
    • Beta-crystallin B1 antibody
    • CATCN3 antibody
    • CRBB1_HUMAN antibody
    • CRYBB 1 antibody
    • Crybb1 antibody
    • Crystallin beta B1 antibody
    • CTRCT17 antibody
    • Eye lens structural protein antibody
    • OTTHUMP00000028719 antibody
    see all

Images

  • Anti-beta B1 Crystallin antibody (ab232799) at 2 µg/ml + Recombinant mouse beta B1 Crystallin protein

    Predicted band size: 28 kDa

  • All lanes : Anti-beta B1 Crystallin antibody (ab232799) at 0.5 µg/ml

    Lane 1 : Mouse eye lysate
    Lane 2 : Rat eye lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/1000 dilution

    Predicted band size: 28 kDa

  • Formalin-fixed, paraffin-embedded mouse liver tissue stained for beta B1 Crystallin using ab232799 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab232799 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232799.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up