Overview

  • Product name

    Anti-Beta crystallin S antibody
    See all Beta crystallin S primary antibodies
  • Description

    Rabbit polyclonal to Beta crystallin S
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rabbit, Cow, Dog
  • Immunogen

    Recombinant full length protein corresponding to Human Beta crystallin S aa 1-178.
    Sequence:

    MSKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVY ERPNFAGYMYILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFE KGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQY LLDKKEYRKPIDWGAASPAVQSFRRIVE


    Database link: P22914

  • Positive control

    • WB: Mouse eye lysate. IHC-P: Human lung cancer and gastric cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229949 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 21 kDa (predicted molecular weight: 21 kDa).

Target

Images

  • Anti-Beta crystallin S antibody (ab229949) at 1/1000 dilution + Mouse eye lysate

    Secondary
    Goat anti-rabbit IgG at 1/10000 dilution

    Predicted band size: 21 kDa
    Observed band size: 21 kDa

  • Paraffin-embedded human lung cancer tissue stained for Beta crystallin S using ab229949 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gastric cancer tissue stained for Beta crystallin S using ab229949 at 1/100 dilution in immunohistochemical analysis.

References

ab229949 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229949.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up