Anti-beta Defensin 1 antibody [M11-14b-D10] (ab14425)

Submit an Abreview Q&A (8)Specific References (5)

Overview

  • Product name
    Anti-beta Defensin 1 antibody [M11-14b-D10]
    See all beta Defensin 1 primary antibodies
  • Description
    Mouse monoclonal [M11-14b-D10] to beta Defensin 1
  • Host species
    Mouse
  • Tested applications
    Suitable for: ELISA, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Baboon, Macaque monkey
  • Immunogen

    Synthetic peptide:

    DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

    , corresponding to amino acids 1-36 of Human beta 1 Defensin.

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    pH: 7.40
    Constituent: 0.79% Tris HCl
  • Concentration information loading...
  • Purity
    Protein L purified
  • Clonality
    Monoclonal
  • Clone number
    M11-14b-D10
  • Isotype
    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab14425 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 8 kDa.Can be blocked with Recombinant human beta Defensin 1 protein (ab50048).
IHC-P Use a concentration of 2 µg/ml.

Target

  • Function
    Has bactericidal activity.
  • Tissue specificity
    Plasma.
  • Sequence similarities
    Belongs to the beta-defensin family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
    • Alternative names
      • BD 1 antibody
      • BD-1 antibody
      • BD1 antibody
      • beta 1 antibody
      • Beta defensin 1 antibody
      • Beta-defensin 1 antibody
      • DEFB 1 antibody
      • DEFB1 antibody
      • DEFB1_HUMAN antibody
      • DEFB101 antibody
      • Defensin antibody
      • Defensin beta 1 antibody
      • Defensin beta 1 preproprotein antibody
      • HBD 1 antibody
      • hBD-1 antibody
      • HBD1 antibody
      • MGC51822 antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-beta Defensin 1 antibody [M11-14b-D10] (ab14425)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-beta Defensin 1 antibody [M11-14b-D10] (ab14425)
      ab14425 (2µg/ml) staining beta defensin in human kidney, using an automated system (DAKO Autostainer Plus). Using this protocol there is strong staining in the epithelial layers of the loops of Henle, distal tubules and collecting ducts.
      Sections were rehydrated and antigen retrieved with the Dako 3 in 1 AR buffer EDTA pH 9.0 in a DAKO PT link. Slides were peroxidase blocked in 3% H2O2 in methanol for 10 mins. They were then blocked with Dako Protein block for 10 minutes (containing casein 0.25% in PBS) then incubated with primary antibody for 20 min and detected with Dako envision flex amplification kit for 30 minutes. Colorimetric detection was completed with Diaminobenzidine for 5 minutes. Slides were counterstained with Haematoxylin and coverslipped under DePeX. Please note that, for manual staining, optimization of primary antibody concentration and incubation time is recommended. Signal amplification may be required.

    References

    This product has been referenced in:
    • Gazi U  et al. Tonsillar antimicrobial peptide (AMP) expression profiles of periodic fever, aphthous stomatitis, pharyngitis, cervical adenitis (PFAPA) patients. Int J Pediatr Otorhinolaryngol 110:100-104 (2018). IHC-P ; Human . Read more (PubMed: 29859567) »
    • Qian YJ  et al. Cigarette Smoke Modulates NOD1 Signal Pathway and Human ß Defensins Expression in Human Oral Mucosa. Cell Physiol Biochem 36:457-73 (2015). Human . Read more (PubMed: 25968832) »

    See all 5 Publications for this product

    Publishing research using ab14425? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Submit a review Submit a question

    8 reviews or Q&A

    10
    Votes: Highest First


    Customer has performed the Dot-Blotprotocolas suggested;please findthe results attached.

    Regarding the storage:
    - antibodies were stored at -20°C.
    - recombinant proteins were reconstituted with 100 ul PBS + 15% glycerol, a...

    Read More

    Thank you for sending along the dot blots and additional information. We really appreciate the extra troubleshootingeffort.

    Here are my thoughts:

    1. In general it looks like the antibodies are able to detect Defensin in the chorioam...

    Read More

    For the technical support,   Please, customer is having problems using human beta defensin antibodies and their respective recombinant proteins in WB applications.   Find bellow the technical questionnaire filled out by the customer.   As the beta ...

    Read More

    Thank you for contacting Abcam Technical Team and for taking the time to provide some useful details of the experiments. I am very sorry to hear that your customer is are having problems with 8 of our products.  Special thanks for collecting the troubl...

    Read More

    we would like to order 2 antibodies from your company: ab14421 (beta 1 defensin, rabbit, polyclonal) and ab14425 (beta 1 defensin, mouse, monoclonal). however, we need a positive control for our western blot and for ELISA. do you provide a positiv...

    Read More

    Thank you for your enquiry. Human beta-1 defensin is expressed in kidney. Therefore, I would suggest you can use a human kidney whole cell lysate such as our peptide product ab30203. I have placed a link here to a reference I hope you may find usef...

    Read More

    I tried this antibody in ELISA at 1:1000, and got no signal.

    Thank you for your enquiry. In testing this antibody, the plates were coated with linear and tri-cyclic ß-Defensins (1 µg/1ml) and a good signal was seen with an antibody-dilution of 0.1 µg/ml. Please find the protocol used in quality testing bel...

    Read More

    BATCH NUMBER -- NOT SPECIFIED -- ORDER NUMBER 128614 DESCRIPTION OF THE PROBLEM I ran a dot blot ELISA using this antibody at a 1:1000 dilution with purified human beta-1-Defensin from Sigma, cat#D9565. The reaction uses BCIP/NBT as...

    Read More

    Thank you for taking the time to submit this enquiry. The Ab that you have been utilising has not been specifically tested for use in dot blot Elisa but standard direct/indirect ELISA. I would be grateful if you could provide me with details relating t...

    Read More

    In response to your enquiry, here is what Autogen Bioclear wrote: "The beta-defensin genes were directly expressed (no tags or leader sequence). Sequences are available (let me know if you require them). After fermentation, centrifugation, cell b...

    Read More

    Thank you for getting back to me with those details, it was very interesting. Unfortunately given that the source of the antisera have not been able to provide me with further details as to the synthesis of the immunising peptides it is difficult f...

    Read More

    Please can you provide details of how the synthetic immunising peptide was made, with particular attention to the formation of the cysteine bridges prior to immunisation.

    Thank you for your enquiry. Further to correspondence with the source of this antiserum I have been informed that the antiserum was raised against tricycle human ß-Defensin 2 antigen. Unfortunately they could not provide details of whether the anti...

    Read More

    is the antigenic site for this antibody on b-1 defensin known? i need one that recognises the n-terminus

    We are sorry, but it is not known to us. It has not been tested.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up