Anti-beta Defensin 1 antibody [M11-14b-D10] (ab14425)
Key features and details
- Mouse monoclonal [M11-14b-D10] to beta Defensin 1
- Suitable for: WB, ELISA, IHC-P
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-beta Defensin 1 antibody [M11-14b-D10]
See all beta Defensin 1 primary antibodies -
Description
Mouse monoclonal [M11-14b-D10] to beta Defensin 1 -
Host species
Mouse -
Tested applications
Suitable for: WB, ELISA, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee, Baboon, Macaque monkey -
Immunogen
Synthetic peptide:
DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
, corresponding to amino acids 1-36 of Human beta 1 Defensin. -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.40
Constituent: 0.79% Tris HCl -
Concentration information loading...
-
Purity
Protein L purified -
Clonality
Monoclonal -
Clone number
M11-14b-D10 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Immunizing Peptide (Blocking)
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab14425 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use at an assay dependent concentration. Can be blocked with Recombinant human beta Defensin 1 protein (ab50048).
|
|
ELISA |
Use at an assay dependent concentration.
|
|
IHC-P |
Use a concentration of 2 µg/ml.
|
Notes |
---|
WB
Use at an assay dependent concentration. Can be blocked with Recombinant human beta Defensin 1 protein (ab50048). |
ELISA
Use at an assay dependent concentration. |
IHC-P
Use a concentration of 2 µg/ml. |
Target
-
Function
Has bactericidal activity. -
Tissue specificity
Plasma. -
Sequence similarities
Belongs to the beta-defensin family. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 1672 Human
- Omim: 602056 Human
- SwissProt: P60022 Human
- Unigene: 32949 Human
-
Alternative names
- BD 1 antibody
- BD-1 antibody
- BD1 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-beta Defensin 1 antibody [M11-14b-D10] (ab14425)ab14425 (2µg/ml) staining beta defensin in human kidney, using an automated system (DAKO Autostainer Plus). Using this protocol there is strong staining in the epithelial layers of the loops of Henle, distal tubules and collecting ducts.
Sections were rehydrated and antigen retrieved with the Dako 3 in 1 AR buffer EDTA pH 9.0 in a DAKO PT link. Slides were peroxidase blocked in 3% H2O2 in methanol for 10 mins. They were then blocked with Dako Protein block for 10 minutes (containing casein 0.25% in PBS) then incubated with primary antibody for 20 min and detected with Dako envision flex amplification kit for 30 minutes. Colorimetric detection was completed with Diaminobenzidine for 5 minutes. Slides were counterstained with Haematoxylin and coverslipped under DePeX. Please note that, for manual staining, optimization of primary antibody concentration and incubation time is recommended. Signal amplification may be required.
Datasheets and documents
-
SDS download
-
Datasheet download
References (9)
ab14425 has been referenced in 9 publications.
- Peled A et al. Loss-of-function mutations in caspase recruitment domain-containing protein 14 (CARD14) are associated with a severe variant of atopic dermatitis. J Allergy Clin Immunol 143:173-181.e10 (2019). PubMed: 30248356
- Roth M et al. Pelargonium sidoides radix extract EPs 7630 reduces rhinovirus infection through modulation of viral binding proteins on human bronchial epithelial cells. PLoS One 14:e0210702 (2019). PubMed: 30707726
- Gazi U et al. Tonsillar antimicrobial peptide (AMP) expression profiles of periodic fever, aphthous stomatitis, pharyngitis, cervical adenitis (PFAPA) patients. Int J Pediatr Otorhinolaryngol 110:100-104 (2018). IHC-P ; Human . PubMed: 29859567
- Bonamy C et al. Expression of the human antimicrobial peptide ß-defensin-1 is repressed by the EGFR-ERK-MYC axis in colonic epithelial cells. Sci Rep 8:18043 (2018). PubMed: 30575780
- Roth M et al. Broncho Vaxom (OM-85) modulates rhinovirus docking proteins on human airway epithelial cells via Erk1/2 mitogen activated protein kinase and cAMP. PLoS One 12:e0188010 (2017). PubMed: 29182620
- Qian YJ et al. Cigarette Smoke Modulates NOD1 Signal Pathway and Human ß Defensins Expression in Human Oral Mucosa. Cell Physiol Biochem 36:457-73 (2015). Human . PubMed: 25968832
- Trend S et al. Antimicrobial protein and Peptide concentrations and activity in human breast milk consumed by preterm infants at risk of late-onset neonatal sepsis. PLoS One 10:e0117038 (2015). ELISA . PubMed: 25643281
- Han Q et al. Human beta-defensin-1 suppresses tumor migration and invasion and is an independent predictor for survival of oral squamous cell carcinoma patients. PLoS One 9:e91867 (2014). IHC ; Human . PubMed: 24658581
- Zoega M et al. Proteinase 3 carries small unusual carbohydrates and associates with alpha-defensins. J Proteomics : (2011). PubMed: 22138257