For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    beta-defensin-1-antibody-m11-14b-d10-ab14425.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Microbiology Protein Human Protein Defensin
Share by email

Anti-beta Defensin 1 antibody [M11-14b-D10] (ab14425)

  • Datasheet
  • SDS
Submit a review Q&A (8)References (9)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-beta Defensin 1 antibody [M11-14b-D10] (ab14425)

    Key features and details

    • Mouse monoclonal [M11-14b-D10] to beta Defensin 1
    • Suitable for: WB, ELISA, IHC-P
    • Reacts with: Human
    • Isotype: IgG1

    You may also be interested in

    Primary
    Product image
    Anti-Von Willebrand Factor antibody [EPR12010] (ab179451)
    Primary
    Anti-BD-3 antibody (ab19270)
    Secondary
    Product image
    Goat Anti-Mouse IgG H&L (HRP) (ab205719)

    View more associated products

    Overview

    • Product name

      Anti-beta Defensin 1 antibody [M11-14b-D10]
      See all beta Defensin 1 primary antibodies
    • Description

      Mouse monoclonal [M11-14b-D10] to beta Defensin 1
    • Host species

      Mouse
    • Tested applications

      Suitable for: WB, ELISA, IHC-Pmore details
    • Species reactivity

      Reacts with: Human
      Predicted to work with: Chimpanzee, Baboon, Macaque monkey
    • Immunogen

      Synthetic peptide:

      DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

      , corresponding to amino acids 1-36 of Human beta 1 Defensin.
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • General notes

      The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

      If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
    • Storage buffer

      pH: 7.40
      Constituent: 0.79% Tris HCl
    • Concentration information loading...
    • Purity

      Protein L purified
    • Clonality

      Monoclonal
    • Clone number

      M11-14b-D10
    • Isotype

      IgG1
    • Research areas

      • Microbiology
      • Protein
      • Human Protein
      • Defensin

    Associated products

    • Compatible Secondaries

      • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
      • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
    • Immunizing Peptide (Blocking)

      • Recombinant human beta Defensin 1 protein (ab50048)
    • Isotype control

      • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
    • Recombinant Protein

      • Recombinant human beta Defensin 1 protein (ab50048)

    Applications

    The Abpromise guarantee

    Our Abpromise guarantee covers the use of ab14425 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB
    Use at an assay dependent concentration. Can be blocked with Recombinant human beta Defensin 1 protein (ab50048).
    ELISA
    Use at an assay dependent concentration.
    IHC-P
    Use a concentration of 2 µg/ml.
    Notes
    WB
    Use at an assay dependent concentration. Can be blocked with Recombinant human beta Defensin 1 protein (ab50048).
    ELISA
    Use at an assay dependent concentration.
    IHC-P
    Use a concentration of 2 µg/ml.

    Target

    • Function

      Has bactericidal activity.
    • Tissue specificity

      Plasma.
    • Sequence similarities

      Belongs to the beta-defensin family.
    • Cellular localization

      Secreted.
    • Target information above from: UniProt accession P60022 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 1672 Human
      • Omim: 602056 Human
      • SwissProt: P60022 Human
      • Unigene: 32949 Human
      • Alternative names

        • BD 1 antibody
        • BD-1 antibody
        • BD1 antibody
        • beta 1 antibody
        • Beta defensin 1 antibody
        • Beta-defensin 1 antibody
        • DEFB 1 antibody
        • DEFB1 antibody
        • DEFB1_HUMAN antibody
        • DEFB101 antibody
        • Defensin antibody
        • Defensin beta 1 antibody
        • Defensin beta 1 preproprotein antibody
        • HBD 1 antibody
        • hBD-1 antibody
        • HBD1 antibody
        • MGC51822 antibody
        see all

      Images

      • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-beta Defensin 1 antibody [M11-14b-D10] (ab14425)
        Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-beta Defensin 1 antibody [M11-14b-D10] (ab14425)
        ab14425 (2µg/ml) staining beta defensin in human kidney, using an automated system (DAKO Autostainer Plus). Using this protocol there is strong staining in the epithelial layers of the loops of Henle, distal tubules and collecting ducts.
        Sections were rehydrated and antigen retrieved with the Dako 3 in 1 AR buffer EDTA pH 9.0 in a DAKO PT link. Slides were peroxidase blocked in 3% H2O2 in methanol for 10 mins. They were then blocked with Dako Protein block for 10 minutes (containing casein 0.25% in PBS) then incubated with primary antibody for 20 min and detected with Dako envision flex amplification kit for 30 minutes. Colorimetric detection was completed with Diaminobenzidine for 5 minutes. Slides were counterstained with Haematoxylin and coverslipped under DePeX. Please note that, for manual staining, optimization of primary antibody concentration and incubation time is recommended. Signal amplification may be required.

      Protocols

      • Immunohistochemistry protocols

      Click here to view the general protocols

      Datasheets and documents

      • SDS download

      • Datasheet download

        Download

      References (9)

      Publishing research using ab14425? Please let us know so that we can cite the reference in this datasheet.

      ab14425 has been referenced in 9 publications.

      • Peled A  et al. Loss-of-function mutations in caspase recruitment domain-containing protein 14 (CARD14) are associated with a severe variant of atopic dermatitis. J Allergy Clin Immunol 143:173-181.e10 (2019). PubMed: 30248356
      • Roth M  et al. Pelargonium sidoides radix extract EPs 7630 reduces rhinovirus infection through modulation of viral binding proteins on human bronchial epithelial cells. PLoS One 14:e0210702 (2019). PubMed: 30707726
      • Gazi U  et al. Tonsillar antimicrobial peptide (AMP) expression profiles of periodic fever, aphthous stomatitis, pharyngitis, cervical adenitis (PFAPA) patients. Int J Pediatr Otorhinolaryngol 110:100-104 (2018). IHC-P ; Human . PubMed: 29859567
      • Bonamy C  et al. Expression of the human antimicrobial peptide ß-defensin-1 is repressed by the EGFR-ERK-MYC axis in colonic epithelial cells. Sci Rep 8:18043 (2018). PubMed: 30575780
      • Roth M  et al. Broncho Vaxom (OM-85) modulates rhinovirus docking proteins on human airway epithelial cells via Erk1/2 mitogen activated protein kinase and cAMP. PLoS One 12:e0188010 (2017). PubMed: 29182620
      • Qian YJ  et al. Cigarette Smoke Modulates NOD1 Signal Pathway and Human ß Defensins Expression in Human Oral Mucosa. Cell Physiol Biochem 36:457-73 (2015). Human . PubMed: 25968832
      • Trend S  et al. Antimicrobial protein and Peptide concentrations and activity in human breast milk consumed by preterm infants at risk of late-onset neonatal sepsis. PLoS One 10:e0117038 (2015). ELISA . PubMed: 25643281
      • Han Q  et al. Human beta-defensin-1 suppresses tumor migration and invasion and is an independent predictor for survival of oral squamous cell carcinoma patients. PLoS One 9:e91867 (2014). IHC ; Human . PubMed: 24658581
      • Zoega M  et al. Proteinase 3 carries small unusual carbohydrates and associates with alpha-defensins. J Proteomics : (2011). PubMed: 22138257

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      1-8 of 8 Abreviews or Q&A

      Question


      Customer has performed the Dot-Blotprotocolas suggested;please findthe results attached.

      Regarding the storage:
      - antibodies were stored at -20°C.
      - recombinant proteins were reconstituted with 100 ul PBS + 15% glycerol, aliquoted andthen stored at -80°C.



      Regarding the WB protocol, she said shealways do the ponceau stain to confirm the transfer, and her transfer buffer does not contain SDS.



      Thank you for you support.



      I am looking forward to hearing from you.

      Read More

      Abcam community

      Verified customer

      Asked on Jan 19 2012

      Answer

      Thank you for sending along the dot blots and additional information. We really appreciate the extra troubleshootingeffort.

      Here are my thoughts:

      1. In general it looks like the antibodies are able to detect Defensin in the chorioamniotic membrane samples.

      2. It does not appear that the antibodies detected recombinant Defensin protein. You note the mass of recombinant protein spotted on the membranes, from 400ng - 0.78ng. Was the concentration of the Defensin proteinconfirmed by Bradford assay or OD280n measurements following reconstitution or are these number based on the expected concentrations after reconstitution?

      If the concentrations are only theoretical, could you please check the concentrations to ensurethey are accurate?

      Thanks again for your troubleshooting efforts. I'm sure we'll be able to resolve this situation soon.

      Read More

      Abcam Scientific Support

      Answered on Jan 19 2012

      Question

      For the technical support,   Please, customer is having problems using human beta defensin antibodies and their respective recombinant proteins in WB applications.   Find bellow the technical questionnaire filled out by the customer.   As the beta defensins are small proteins (8 kDa), it seems this might be the origin of the problem. Maybe, the customer is losing these small bands during the running or even during the transfer. Could you please verify her protocol and give suggestions on how to solve this problem?   Thank you in advance.   Kind Regards, Abcam WB Questionnaire   1) Abcam product code ab14425 + ab50048 ab66072 + ab9872 ab19270 + ab50059 ab14419 + ab69499                            2) Lot number ab14425: GR 17872-2 + ab50048: GR 45073-1 ab66072: GR 40785-1 + ab9872: GR 11654-6 ab19270: GR 730-1 + ab50059: GR 1609-2 ab14419: GR 21054-1 + ab69499: GR 3598-2     3) Antibody storage conditions (temperature/reconstitution etc) Antibodies: stored at -20 ºC. Recombinant proteins: after adding 100 ul PBS + 15% glycerol we aliquoted each one and stored at -80°C.   4) Description of the problem (high background, wrong band size, more bands, no band etc.) No bands using the beta defensin antibodies with their respective recombinant protein and no bands with lysate of chorioamniotic membrane.   5) Sample (Species/Cell extract/Nuclear extract/Purified protein/Recombinant protein etc.) Human recombinant proteins and lysate of chorioamniotic membrane tissue from human.   6) Sample preparation (Buffer/Protease inhibitors/Heating sample etc.) Lysis buffer: - 50mM Tris HCl pH 7,4 - 0,2mM NaCl - 0,1% Triton X-100 - 10mM CaCl2 - 10ul/mL Protease inhibitor from GE Healthcare   Heating sample for 5 min at 100ºC.     7) Amount of protein loaded 30ug   8) Electrophoresis/Gel conditions (Reducing or Non-reducing gel, % of the gel etc.) 15% gel Running at 100 V for 1h30min Sample buffer (4x): - 250mM Tris-HCl 0,5M pH:6,8 - 8% SDS - 20% B-mercaptoethanol - 0,012g bromophenol blue -100 mL milli-Q water - 30% glycerol     9) Transfer and blocking conditions (Buffer/time period, Blocking agent etc.) Transfer: 1h30min at 120V Transfer buffer: 9,7g Tris, 57,6g glycine, 3,2L distilled water and 0,8L methanol Transfer membranes tested: 0,45µm Hybond membrane from Amersham and 0,22µm membrane from Millipore.   Blocking conditions tested: 5% non-fat Milk diluted in TBS-T for 1h at room temperature under agitation. 5% non-fat Milk diluted in TBS-T for 2h at room temperature under agitation. 10% non-fat Milk diluted in TBS-T for 1h at room temperature under agitation. 10% non-fat Milk diluted in TBS-T for 2h at room temperature under agitation.   10) Primary Antibody (Manufacturer/Species/Diluent/Dilution/Incubation time, Wash step) 1. Human Beta Defensin-1:  ab14425 (antibody) + ab50048 (rec protein) Tested dilutions: 1:500 and 1:250 for the antibody and 200 ng for the recombinant protein   2. Human Beta Defensin-2: ab66072 (antibody) + ab9872 (rec protein) Tested dilutions: 1:1000 and 1:500 for the antibody and 200 ng for the recombinant protein   3.  Human Beta Defensin-3: ab19270 (antibody) + ab50059 (rec protein) Tested dilutions: 1:1000 and 1:500 for the antibody and 200 ng for the recombinant protein   3.  Human Beta Defensin-4: ab14419 (antibody) + ab69499 (rec protein) Tested dilutions: 1:500 and 1:250 for the antibody and 200 ng for the recombinant protein   All antibodies were diluted in TBST + 5% milk and incubated overnight at 4°C under agitation. We also tried to dilute them in TBST + 5% BSA.   Wash step: 3x 5 min in TBST   11) Secondary Antibody (Manufacturer/Species/Diluent/Dilution/Incubation time, Wash step) Goat anti-mouse IgG HRP for ab14425, ab66072 and ab14419. Dilution: 1:5000 diluted in TBST +5% milk Incubation: 1 h   Goat anti-rabbit IgG HRP F(ab’) fragment for ab19270. Dilution: 1:5000 diluted in TBST +5% milk Incubation: 1 h   Wash step: 3x 5 min in TBST   12) Detection method (ECL, ECLPlus etc.) ECL Plus - Amersham   13) How many times have you tried the Western? 20 times   14) Do you obtain the same results every time? e.g. are the background bands always in the same place? The results we have are always the same for the 4 proteins. The respective bands of recombinant protein and sample do not appear. The running and transfer conditions are ok, because we have positive results with beta actin antibody in the same membranes. Also, the secondary antibody is working fine with beta actin.   15) What steps have you altered to try and optimize the use of this antibody? Primary antibody dilution, transfer membranes, blocking conditions...      

      Read More

      Abcam community

      Verified customer

      Asked on Nov 30 2011

      Answer

      Thank you for contacting Abcam Technical Team and for taking the time to provide some useful details of the experiments. I am very sorry to hear that your customer is are having problems with 8 of our products.  Special thanks for collecting the troubled customer's data/results in such an organized way. It may well be that the problem is either shipment/storage or protocol-related. Though you have kindly provided some details, it would be much appreciated if I could get some more information which would help me identify the source of the problem.   1) Arrival dates: Could you please confirm the exact dates when the customer received these items: - ab14425, ab50048, ab66072, ab9872, ab19270, ab50059, ab14419, ab69499 2) Orders and shipment: - Could you provide me the Abcam Order Numbers for these products? - Were these items shipped in the same package or not? 3) Marker bands: - What MW markers (i.e. range of the proteins for MW) were used for WB? I am particularly interested in the markers at the lower weight range. 4) Image: - Could you please attach an image representing the samples and the loading control on the same gels? 5) Secondary antibodies: - Has the customer used the respective secondary antibodies successfully with other primary antibodies? Could you please check if the problem does not come from the 2ndaries?   Thank you for your understanding and co-operation in this matter. I look forward to hearing from you and hope to solve this problem as soon as possible.

      Read More

      Abcam Scientific Support

      Answered on Nov 30 2011

      Question

      we would like to order 2 antibodies from your company: ab14421 (beta 1 defensin, rabbit, polyclonal) and ab14425 (beta 1 defensin, mouse, monoclonal). however, we need a positive control for our western blot and for ELISA. do you provide a positive control for human beta 1 defensin (e.g. cell lysate)? how long would it take to deliver these antibodies to austria?

      Read More

      Abcam community

      Verified customer

      Asked on Aug 30 2006

      Answer

      Thank you for your enquiry. Human beta-1 defensin is expressed in kidney. Therefore, I would suggest you can use a human kidney whole cell lysate such as our peptide product ab30203. I have placed a link here to a reference I hope you may find useful from BMC Infectious Diseases; Expression of human beta-defensins 1 and 2 in kidneys with chronic bacterial infection (Jan Lehmann1 et al) http://www.biomedcentral.com/content/pdf/1471-2334-2-20.pdf Alternatively, you could use a purified beta-1 defensin peptide/protein. I hope this is helpful. Please do not hesitate to contact us again if you require more assistance.

      Read More

      Abcam Scientific Support

      Answered on Aug 31 2006

      Question

      I tried this antibody in ELISA at 1:1000, and got no signal.

      Read More

      Abcam community

      Verified customer

      Asked on Feb 28 2006

      Answer

      Thank you for your enquiry. In testing this antibody, the plates were coated with linear and tri-cyclic ß-Defensins (1 µg/1ml) and a good signal was seen with an antibody-dilution of 0.1 µg/ml. Please find the protocol used in quality testing below. I hope this information helps, please do not hesitate to contact us if you need any more advice or information. We coated with linear and tri-cyclic ß-Defensins (1 µg/1ml) and we achieved a good signal having an antibody-dilution of 0,1 µg/ml. REAGENTS Coating buffer: 0.05 M Na2CO3 adjust pH to 9.6 with solid NaHCO3 Blocking buffer: 2% BSA in PBS Washbuffer: 1.37 Nacl, 26.8 mM KCl, 14.7mM KH2PO4, 81 mM Na2HPO4, 1 % TRITON-X-100, 0.02% THIMEROSAL First antibody: dilute in 2% BSA in PBS Second antibody: dilute in wash buffer Substrate : TMB-solution (BIOFX, USA) Stop solution: 0.4 M H2SO4 Microtiterplate NUNC Medisorb PROCEDURE • pipette 100 µl of peptide (1000 ng/ml in coating buffer) into the wells of a microtitre plate • incubate over night at 4°C • decant the contents of the plate and add 250 µl blocking buffer • incubate 1 hour at room temperature, shaking on a horizontal mixer • decant the content of the plate and wash the cavities 5 x with 250 µl of wash buffer • pipette 100 µl of antiserum (respective dilution in 2% BSA / PBS) • incubate at least 3 hrs at room temperature (or over night at 4°C), shaking on a horizontal mixer • decant the content of the plate and wash the cavities 5 x with 250 µl of wash buffer • pipette 100 µl of POX-labelled second antibody (e.g. if first antibody is rabbit: donkey anti-rabbit-POX can be used at 1: 10000 in wash buffer) • incubate 1 hr at room temperature, shaking on a horizontal mixer • decant the content of the plate and wash the cavities 5 x with 250 µl of wash buffer • pipette 100 µl TMB-solution • incubate for 15 - 30 minutes at room temperature, shaking slightly, until sufficient color differentiation has been observed • add 50 µl of stop solution and mix shortly • measure the extinction of the samples at 450 nm (reference wave length 620 nm)

      Read More

      Abcam Scientific Support

      Answered on Mar 01 2006

      Question

      BATCH NUMBER -- NOT SPECIFIED -- ORDER NUMBER 128614 DESCRIPTION OF THE PROBLEM I ran a dot blot ELISA using this antibody at a 1:1000 dilution with purified human beta-1-Defensin from Sigma, cat#D9565. The reaction uses BCIP/NBT as the substrate for Alkaline Phosphatase. I got no reaction. POSITIVE AND NEGATIVE CONTROLS USED human, beta-1-Defensin ANTIBODY STORAGE CONDITIONS The antibody did not require reconstitution and I am storing it at -20C. It was not shipped frozen or refrigerated and this may be the cause of the problem. TYPE OF ELISA Direct ELISA using Invitrogen WesternBreeze Chromogenic Immunodetection Kit. BLOCKING CONDITIONS one hour at 37C HOW MANY TIMES HAVE YOU TRIED THE APPLICATION? 2 HAVE YOU RUN A "NO PRIMARY" CONTROL? No DO YOU OBTAIN THE SAME RESULTS EVERY TIME? Yes

      Read More

      Abcam community

      Verified customer

      Asked on Feb 28 2006

      Answer

      Thank you for taking the time to submit this enquiry. The Ab that you have been utilising has not been specifically tested for use in dot blot Elisa but standard direct/indirect ELISA. I would be grateful if you could provide me with details relating to the protocol that you have utilised in order for me to look into this matter in more detail. My initial concern would be that a kit that has been specifically design for Western blot analysis is being utilised as a detection system. The “Western Breeze” procedure specifically mentions not allowing the membrane to dry out; however I believe that during dot blot ELISA the antigen is spotted onto air dried membrane (pre soaked in PBS) before being dried for a further hour. Do you have a standard protocol for dot blot ELISA within your lab, as I would be inclined to optimise a published dot blot protocol rather than utilising kits optimised for use in other applications. I look forward to hearing form you shortly.

      Read More

      Abcam Scientific Support

      Answered on Mar 01 2006

      Question

      In response to your enquiry, here is what Autogen Bioclear wrote: "The beta-defensin genes were directly expressed (no tags or leader sequence). Sequences are available (let me know if you require them). After fermentation, centrifugation, cell breakage; the proteins are folded into its active form during the folding/oxidation stage, this is when the disulfide bridges form. Specific processes are proprietary. The beta-defensins have a characteristic 6 cysteine structural motif containing 3 disulfide-bridges." I have tested the performance of your antibody against the denatured forms of my standards, HBD-1 (36aa and 47aa), HBD-2 and HBD-3. Unfortunately these results were negative and the only positive results were the native forms of HBD-1 36 and 47 aa, which gave a clear signal on the dot blot. Best regards

      Read More

      Abcam community

      Verified customer

      Asked on Nov 03 2005

      Answer

      Thank you for getting back to me with those details, it was very interesting. Unfortunately given that the source of the antisera have not been able to provide me with further details as to the synthesis of the immunising peptides it is difficult for me to comment on whether they have been raised against a correctly folded immunogen. If this was indeed the case then one might speculate that these antibodies only recognise the synthetic peptide and not the native form of the protein. However, checking back to past orders and this antibody is relatively popular and we have not received any complaints as such. I can but speculate that the absence of western or dot blot as applications on the datasheets is a reflection that these antibodies do not recognise their epitopes when immobilised on a membrane.

      Read More

      Abcam Scientific Support

      Answered on Nov 03 2005

      Question

      Please can you provide details of how the synthetic immunising peptide was made, with particular attention to the formation of the cysteine bridges prior to immunisation.

      Read More

      Abcam community

      Verified customer

      Asked on Oct 24 2005

      Answer

      Thank you for your enquiry. Further to correspondence with the source of this antiserum I have been informed that the antiserum was raised against tricycle human ß-Defensin 2 antigen. Unfortunately they could not provide details of whether the antisera had been tested against the native protein or your protein standards. I have therefore not been able to find evidence that these sera have been tested against the native form of this protein. I would definitely be interested to know how these sera performed against the denatured forms of your standards.

      Read More

      Abcam Scientific Support

      Answered on Oct 27 2005

      Question

      is the antigenic site for this antibody on b-1 defensin known? i need one that recognises the n-terminus

      Read More

      Abcam community

      Verified customer

      Asked on Nov 08 2004

      Answer

      We are sorry, but it is not known to us. It has not been tested.

      Read More

      Abcam Scientific Support

      Answered on Nov 10 2004

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2022 Abcam plc. All rights reserved.