Anti-beta Galactosidase antibody (ab221199)

Rabbit polyclonal beta Galactosidase antibody. Validated in WB, IP, ICC/IF and tested in Escherichia coli. Immunogen corresponding to recombinant full length protein.

Overview

  • Product name

    Anti-beta Galactosidase antibody
    See all beta Galactosidase primary antibodies
  • Description

    Rabbit polyclonal to beta Galactosidase
  • Host species

    Rabbit
  • Specificity

    This antibody recognizes beta Galactosidase from E coli and beta Galactosidase tagged proteins.
  • Tested applications

    Suitable for: WB, IP, ICC/IFmore details
  • Species reactivity

    Reacts with: Escherichia coli
  • Immunogen

    Recombinant full length protein corresponding to Escherichia coli beta Galactosidase aa 1-1024.
    Sequence:

    MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQ QLRSLNGEWQ FVWFPAPEAVPESWLECDLPDADTVVVPSNWQMHGYDA PIYTNVTYPITVNPPFVPAENP TGCYSLTFNIDECWLQEGQTRIIFDG VNSAFHLWCNGRWVGYGQDSRLPSEFDLSAFLRA GKNRLAVMVLRWSD GSYLEDQDMWRMSGIFRDVSLLHKPTTQISDFHVATRFNDDFSRAV LE AEVQMYGELRDELRVTVSLWQGETQVASGTAPFGGEIIDERGGYADRVTL RLNVENPA LWSAEIPNIYRAVVELHTADGTLIEAEACDVGFREVRIEN GLLLLNGKPLLIRGVNRHEH HPLHGQVMDEQTMVQDILLMKQNNFNAV RCSHYPNHPLWYTLCDRYGLYVVDEANIETHG MVPMNRLTDDPRWLPA MSERVTRMVLRDRNHPSVIIWSLGNESGHGANHDALYRWIKSVD PSRP VQYEGGGADTTATDIICPMYARVDEDQPFPAVPKWSIKKWLSLPGELRPL ILCEYA HAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSLIKYDEN GNPWSAYGGDFGDTPNDR QFCMNGLVFADRTPHPALTEAKHQQQFFQF RLSGRTIEVTSEYLFRHSDNELLHWTVALD GKPLASGEVPLDVAPQGK QVIELPELPQPESAGQLWLTVHVVQPNATAWSEAGHISAWQQ WRLAEN LSVTLPTASHAIPHLTTSEMDFCIELGNKRWQFNRQSGFLSQMWIGDEKQ LLTP LRDQFTRAPLDNDIGVSEATRIDPNAWVERWKAAGHYQAEAALL QCTADTLADAVLITTA HAWQHQGKTLFISRKTYRIDGSGQMAITVDVE VASDTPHPARIGLTCQLAQVAERVNWLG LGPQENYPDRLTAACFDRWD LPLSDMYTPYVFPSENGLRCGTRELNYGPHQWRGDFQFNI SRYSQQQL METSHRHLLHAEEGTWLNIDGFHMGIGGDDSWSPSVSAEFQLSAGRYHYQ LV WCQK


    Database link: B7UJI9

  • Positive control

    • Purified beta Galactosidase; IPTG induced E.coli K12 cell extract; HEK293A cells transfected with beta Galactosidase cDNA.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituents: 50% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221199 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 116 kDa.
IP 1/200 - 1/500.
ICC/IF 1/200 - 1/500.

Target

  • Relevance

    Beta galactosidase is coded by a gene (lac z) in the lac operon of Escherichia coli. It is a metalloenzyme that splits lactose into glucose and galactose. It hydrolyzes terminal, non-reducing beta-D-galactose residues in beta-D-galactosides. Activation by cations seems to be substrate dependent. K+, Na+, NH4+, Rb+, Cs+ and Mn++ all activate enzyme activity based upon the substrate used.
  • Cellular localization

    Cytoplasmic
  • Database links

    • Alternative names

      • Beta D galactosidase antibody
      • Beta gal antibody
      • Beta galactosidase antibody
      • ECK0341 antibody
      • JW0335 antibody
      • Lactase antibody
      • lacZ antibody
      see all

    Images

    • Immunofluorescent analysis of HEK293A cells transfected with beta Galactosidase cDNA (4% PFA-fixed, methanol permeabilized) labeling beta Galactosidase with ab221199 at 1/500 dilution, followed by secondary detection with Alexa Fluor 555 conjugated anti rabbit IgG at 1/500 dilution (red). Hoecst 33342 was used for nuclear counterstaining (blue).

    • All lanes : Anti-beta Galactosidase antibody (ab221199) at 1/1000 dilution

      Lane 1 : purified beta Galactosidase at 0.01 µg
      Lane 2 : uninduced E coli cell extract at 30 µg
      Lane 3 : ITPG induced E coli cell extract at 30 µg

      Predicted band size: 116 kDa

    • beta Galactosidase was immunorecipitated from ITPG induced E coli crude extracts using ab221199 at 1/500 dilution.

      Western blot detection was performed using ab221199 at 1/1000 dilution. 

      Lane 1: Crude extract

      Lane 2: Supernatant of the immunoprecipitated E. coli crude extract

      Lane 3: Immunoprecipitate of crude E. coli extract

    References

    ab221199 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab221199.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up