Overview

  • Product name

    Anti-beta I Tubulin antibody
    See all beta I Tubulin primary antibodies
  • Description

    Rabbit polyclonal to beta I Tubulin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human beta I Tubulin aa 166-451. Expressed in E. coli. N-terminal tags.
    Sequence:

    SFSVMPSPKVSDTVVEPYNAVLSIHQLIENADACFCIDNEALYDICFRTL KLTTPTYGDLNHLVSLTMSGITTSLRFPGQLNADLRKLAVNMVPFPRLHF FMPGFAPLTAQGSQQYRALSVAELTQQMFDARNTMAACDLRRGRYLTVAC IFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRGLSMAA TFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNI HDLVSEYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH


    Database link: Q9H4B7

  • Positive control

    • WB: Recombinant human beta I Tubulin protein; pig cerebrum tissue and U-87 MG whole cell lysate. IHC-P: Human stomach tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232770 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 50 kDa.

Target

  • Function

    Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
  • Involvement in disease

    Defects in TUBB1 are a cause of macrothrombocytopenia autosomal dominant TUBB1-related (MAD-TUBB1) [MIM:613112]. It is a congenital blood disorder characterized by increased platelet size and decreased number of circulating platelets.
  • Sequence similarities

    Belongs to the tubulin family.
  • Post-translational
    modifications

    Some glutamate residues at the C-terminus are polyglutamylated. This modification occurs exclusively on glutamate residues and results in polyglutamate chains on the gamma-carboxyl group. Also monoglycylated but not polyglycylated due to the absence of functional TTLL10 in human. Monoglycylation is mainly limited to tubulin incorporated into axonemes (cilia and flagella) whereas glutamylation is prevalent in neuronal cells, centrioles, axonemes, and the mitotic spindle. Both modifications can coexist on the same protein on adjacent residues, and lowering glycylation levels increases polyglutamylation, and reciprocally. The precise function of such modifications is still unclear but they regulate the assembly and dynamics of axonemal microtubules.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2810484G07Rik antibody
    • beta 1 tubulin antibody
    • Beta tubulin 1, class VI antibody
    • Beta-tubulin antibody
    • Class VI beta tubulin antibody
    • dJ543J19.4 antibody
    • M(beta)1 antibody
    • TBB1_HUMAN antibody
    • TUBB1 antibody
    • Tubulin beta 1 class VI antibody
    • Tubulin beta-1 chain antibody
    • Tubulin, beta 1 antibody
    • tubulin, beta1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for beta I Tubulin using ab232770 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-beta I Tubulin antibody (ab232770) at 2 µg/ml + Pig cerebrum tissue lysate

    Predicted band size: 50 kDa

  • Anti-beta I Tubulin antibody (ab232770) at 2 µg/ml + U-87 MG (human glioblastoma-astrocytoma epithelial cell line) whole cell lysate

    Predicted band size: 50 kDa

  • Anti-beta I Tubulin antibody (ab232770) at 2 µg/ml + Recombinant human beta I Tubulin protein

    Predicted band size: 50 kDa

References

ab232770 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232770.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up