Overview

  • Product name

    Anti-beta Synuclein antibody - C-terminal
    See all beta Synuclein primary antibodies
  • Description

    Rabbit polyclonal to beta Synuclein - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Synthetic peptide corresponding to Human beta Synuclein aa 85-134 (C terminal).
    Sequence:

    KREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA


    Database link: Q16143

  • Positive control

    • Human brain (cortex) tissue. A549 cells and HeLa cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab189276 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/100 - 1/500.
WB 1/500 - 1/1000. Predicted molecular weight: 14 kDa.
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

  • Function

    Non-amyloid component of senile plaques found in Alzheimer disease. Could act as a regulator of SNCA aggregation process. Protects neurons from staurosporine and 6-hydroxy dopamine (6OHDA)-stimulated caspase activation in a p53/TP53-dependent manner. Contributes to restore the SNCA anti-apoptotic function abolished by 6OHDA. Not found in the Lewy bodies associated with Parkinson disease.
  • Tissue specificity

    Expressed predominantly in brain; concentrated in presynaptic nerve terminals.
  • Sequence similarities

    Belongs to the synuclein family.
  • Post-translational
    modifications

    Phosphorylated. Phosphorylation by G-protein coupled receptor kinases (GRK) is more efficient than phosphorylation by CK1, CK2 and CaM-kinase II.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 14 kDa brain-specific protein antibody
    • Beta-synuclein antibody
    • Phosphoneuroprotein 14 antibody
    • PNP14 antibody
    • Sncb antibody
    • Synuclein beta antibody
    • SYUB_HUMAN antibody
    see all

Images

  • All lanes : Anti-beta Synuclein antibody - C-terminal (ab189276) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : HeLa cell lysate with synthesized peptide

    Predicted band size: 14 kDa

  • Immunohistochemistry of formalin-fixed, paraffin-embedded Human brain cortex tissue labeling beta Synuclein with ab189276 at 10 µg/ml.

  • Immunofluorescent analysis of A549 cells beta Synuclein with ab189276 at 1/100 dilution (left). Right panel is treated with the immunizing peptide.

References

ab189276 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189276.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up