
Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901)


  • Product name
    Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker
    See all beta Tubulin primary antibodies
  • Description
    Rabbit monoclonal [EP1331Y] to beta Tubulin - Microtubule Marker
  • Host species
  • Tested applications
    Suitable for: WB, IP, IHC-P, IHC-Frmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human, Zebrafish
  • Immunogen

    Synthetic peptide within Human beta Tubulin aa 400 to the C-terminus (C terminal). The exact sequence is proprietary.
    Database link: P07437

  • Positive control
    • WB: PC12 and HeLa whole cell lysate (ab150035) and mouse brain, rat brain, mouse spinal cord and rat spinal cord tissue lysates. IHC-P: Human gastric carcinoma. ICC/IF: HeLa cells.
  • General notes

    A trial size is available to purchase for this antibody.


    Our RabMAb® technology is a patented hybridoma-based technology for making rabbit monoclonal antibodies. For details on our patents, please refer to RabMab® patents.

    This product is a recombinant rabbit monoclonal antibody.



Our Abpromise guarantee covers the use of ab52901 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/20000. Detects a band of approximately 50 kDa (predicted molecular weight: 50 kDa).
IP 1/50.
IHC-P Use at an assay dependent concentration.
IHC-Fr 1/100.


  • Function
    Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
  • Tissue specificity
    Ubiquitously expressed with highest levels in spleen, thymus and immature brain.
  • Involvement in disease
    Cortical dysplasia, complex, with other brain malformations 6
    Skin creases, congenital symmetric circumferential, 1
  • Sequence similarities
    Belongs to the tubulin family.
  • Domain
    The highly acidic C-terminal region may bind cations such as calcium.
  • Post-translational
    Some glutamate residues at the C-terminus are polyglutamylated, resulting in polyglutamate chains on the gamma-carboxyl group (PubMed:26875866). Polyglutamylation plays a key role in microtubule severing by spastin (SPAST). SPAST preferentially recognizes and acts on microtubules decorated with short polyglutamate tails: severing activity by SPAST increases as the number of glutamates per tubulin rises from one to eight, but decreases beyond this glutamylation threshold (PubMed:26875866).
    Some glutamate residues at the C-terminus are monoglycylated but not polyglycylated due to the absence of functional TTLL10 in human. Monoglycylation is mainly limited to tubulin incorporated into axonemes (cilia and flagella). Both polyglutamylation and monoglycylation can coexist on the same protein on adjacent residues, and lowering glycylation levels increases polyglutamylation, and reciprocally. The precise function of monoglycylation is still unclear.
    Phosphorylated on Ser-172 by CDK1 during the cell cycle, from metaphase to telophase, but not in interphase. This phosphorylation inhibits tubulin incorporation into microtubules.
  • Cellular localization
    Cytoplasm, cytoskeleton.
  • Information by UniProt
  • Database links
  • Alternative names
    • Beta 4 tubulin antibody
    • Beta 5 tubulin antibody
    • beta Ib tubulin antibody
    • Beta1 tubulin antibody
    • Class I beta tubulin antibody
    • M40 antibody
    • MGC117247 antibody
    • MGC16435 antibody
    • OK/SW cl.56 antibody
    • OK/SWcl.56 antibody
    • TBB5_HUMAN antibody
    • TUBB 1 antibody
    • TUBB 2 antibody
    • TUBB 5 antibody
    • TUBB antibody
    • TUBB1 antibody
    • TUBB2 antibody
    • TUBB5 antibody
    • tubulin beta 1 chain antibody
    • Tubulin beta 2 chain antibody
    • tubulin beta 5 chain antibody
    • Tubulin beta chain antibody
    • Tubulin beta class I antibody
    • tubulin beta polypeptide antibody
    • Tubulin beta-5 chain antibody
    see all


  • All lanes : Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901) at 1/20000 dilution

    Lane 1 : Brain (Mouse) Tissue Lysate
    Lane 2 : Brain (Rat) Tissue Lysate
    Lane 3 : Spinal Cord (Mouse) Tissue Lysate
    Lane 4 : Spinal Cord (Rat) Tissue Lysate
    Lane 5 : PC12 (Rat adrenal pheochromocytoma cell line) Whole Cell Lysate

    Lysates/proteins at 20 µg per lane.

    All lanes : Goat Anti-Rabbit IgG H&L (Alexa Fluor® 790) (ab175781) at 1/10000 dilution

    Predicted band size: 50 kDa
    Observed band size: 52 kDa
    why is the actual band size different from the predicted?

    This blot was produced using a 4-12% Bis-tris gel under the MOPS buffer system. The gel was run at 200V for 50 minutes before being transferred onto a Nitrocellulose membrane at 30V for 70 minutes. The membrane was then blocked for an hour using Licor blocking buffer before being incubated with ab52901 overnight at 4°C. Antibody binding was detected using ab175781 at a 1:10,000 dilution for 1hr at room temperature and then imaged using the Licor Odyssey CLx.

  • IHC-Fr image of beta Tubulin staining on zebrafish retina sections using ab52901 (1:100). The sections were paraformaldehyde and permeabilized using Triton-X. Antigen retrieval was performed using Sodium Citrate and blocking was perfomed using 5% BSA for 1 hour at 23°C. ab52901 was diluted 1:100 and incubated with the sections for 16 hours at 4°C. The secondary antibody was goat polyclonal to rabbit IgG conjugated to Alexa Fluor 488 (1:1000).

    See Abreview

  • Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901) at 1/20000 dilution + HeLa cell lysate at 10 µg

    goat anti-rabbit HRP at 1/2000 dilution

    Predicted band size: 50 kDa
    Observed band size: 50 kDa

  • ab52901 at 1/250 dilution staining beta Tubulin in human gastric carcinoma by Immunohistochemsitry, Paraffin embedded tissue.

  • Anti-beta Tubulin antibody [EP1331Y] - Microtubule Marker (ab52901) at 1/1000 dilution (in PBS +0.5% Tween20 for 2 hours at 23°C) + 293 human embryonic kidney whole cell lysate at 25 µg

    An HRP-conjugated Goat anti-rabbit IgG polyclonal at 1/10000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Predicted band size: 50 kDa
    Observed band size: 55 kDa why is the actual band size different from the predicted?

    Exposure time: 45 seconds

    Blocking Step: 5% Milk for 1 hour at 23°C

    See Abreview


This product has been referenced in:
  • Eeka P & Phanithi PB Cytotoxic T Lymphocyte Granzyme-b mediates neuronal cell death during Plasmodium berghei ANKA induced experimental cerebral malaria. Neurosci Lett 664:58-65 (2018). Read more (PubMed: 29129674) »
  • Nie SD  et al. High glucose forces a positive feedback loop connecting ErbB4 expression and mTOR/S6K pathway to aggravate the formation of tau hyperphosphorylation in differentiated SH-SY5Y cells. Neurobiol Aging 67:171-180 (2018). Read more (PubMed: 29674181) »
See all 28 Publications for this product

Customer reviews and Q&As

1-10 of 10 Abreviews or Q&A

Immunocytochemistry/ Immunofluorescence
Human Cell (induced Neuron)
induced Neuron
Blocking step
BSA as blocking agent for 30 minute(s) · Concentration: 1% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Dec 16 2015

Immunocytochemistry/ Immunofluorescence
Rat Cell (Cryopreserved embryonic cortical neurons (QBMcells)
Cryopreserved embryonic cortical neurons (QBMcells
paraformaldehyde with picric acid

Ms. Babben Tinner

Verified customer

Submitted Feb 26 2015

Immunohistochemistry (Frozen sections)
Zebrafish Tissue sections (Retina, Inner plexiform layer, ganglion cell)
Yes - Triton X
Retina, Inner plexiform layer, ganglion cell
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C

Dr. Ryan Macdonald

Verified customer

Submitted Aug 22 2014

Abcam guarantees this product to work in the species/application used in this Abreview.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Mouse Tissue sections (skin tumor)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: 10mm Sodium Citrate PH 6.0
skin tumor
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Feb 12 2013


Thank you for contacting us. The exact epitope is proprietary information, however I can confirm that it is a synthetic peptide from within the following region corresponding to C terminal amino acids 400-430 of Human beta III Tubulin: EGMDEMEFTEAESNMNDLVSEYQQYQDATA I have performed a BLAST and this region show similarity to other beta-tubulin antibodies therefore it is likely to cross-react. Please do not hesitate to contact me should you have further questions.

Read More


thank you for your enquiry. I understand you concerns and it is regrettable you have previously experienced an error on another datasheet. This is unusual and we endevour to ensure that all the information we have on our datasheets and from our sources is correct. I can confirm that ab52901 Anti-beta III Tubulin antibody [EP1331Y] has been tested in IP. It will be covered by our guarantee for this application. If it does not work in IP we will be able to provide a refund, free of charge replacement or credit note if we are contacted within 6 months of purchase. I am sorry the cross-reactivity with any other beta tubulin isoforms has not specifically been tested in the laboratory. The immunogen shares 100% identity with tubulin beta-2C chain and tubulin beta-3 chain, so it is predicted to cross-react with other isoforms. I hope this information is helpful to you. Should you have any further questions, please do not hesitate to contact us.

Read More
Abcam guarantees this product to work in the species/application used in this Abreview.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Rat Tissue sections (Brain)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Tris/EDTA ph9.0

Herr Dr. Markus Kipp

Verified customer

Submitted Mar 25 2011

Abcam guarantees this product to work in the species/application used in this Abreview.
Western blot
Mouse Cell lysate - whole cell (cultured cortical neurons)
Gel Running Conditions
Reduced Denaturing (4-12%)
Loading amount
20 µg
cultured cortical neurons
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C

Abcam user community

Verified customer

Submitted Dec 01 2010

Abcam guarantees this product to work in the species/application used in this Abreview.
Western blot
Human Cell lysate - whole cell (293 human embryonic kidney)
Gel Running Conditions
Reduced Denaturing (4-12%)
Loading amount
25 µg
293 human embryonic kidney
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C

Abcam user community

Verified customer

Submitted Sep 07 2010

Abcam has not validated the combination of species/application used in this Abreview.
Immunocytochemistry/ Immunofluorescence
Human Cell (293 human embryonic kidney)
Yes - 0,5%(w/v) saponin
293 human embryonic kidney
Blocking step
Serum as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 23°C

Abcam user community

Verified customer

Submitted Aug 26 2010


Sign up