Anti-Betatrophin antibody (ab168167)
Key features and details
- Mouse polyclonal to Betatrophin
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Betatrophin antibody
See all Betatrophin primary antibodies -
Description
Mouse polyclonal to Betatrophin -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human Betatrophin aa 1-251. (AAI46553.1)
Sequence:MGDALPPFPGAQPLTGRAWLGSSPVMYCTRTARLRTEPWRLLKLRLLYLR PSVMPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQ ALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLE TQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYR EFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALP A
-
Positive control
- Betatrophin transfected 293T cell lysate
-
General notes
This product was previously labelled as C19orf80
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab168167 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 22 kDa. |
Target
-
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 55908 Human
- SwissProt: Q6UXH0 Human
- Unigene: 534467 Human
-
Alternative names
- Angiopoietin-like protein 8 antibody
- ANGPTL8 antibody
- betatrophin antibody
see all
Images
-
All lanes : Anti-Betatrophin antibody (ab168167) at 1 µg/ml
Lane 1 : Betatrophin transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat Anti-Mouse IgG HRP at 1/2500 dilution
Predicted band size: 22 kDa
Datasheets and documents
References (0)
ab168167 has not yet been referenced specifically in any publications.