Overview

  • Product name
    Anti-BEX4 antibody - N-terminal
    See all BEX4 primary antibodies
  • Description
    Rabbit polyclonal to BEX4 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 28-77 (

    PTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRHIEHNEAR

    ) of Human BEX4 (NM_001127688).

  • Positive control
    • HCT15 cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab136317 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 14 kDa.

Target

  • Relevance
    Bex proteins are expressed from a family of "brain expressed X-linked genes".
  • Cellular localization
    Cytoplasmic and Nuclear
  • Database links
  • Alternative names
    • BEX family member 4 antibody
    • BEX1 like 1 antibody
    • BEX1 like protein 1 antibody
    • BEXL1 antibody
    • brain expressed gene 4 antibody
    • Brain expressed X linked like 1 antibody
    • Brain expressed X linked protein 4 antibody
    • Brain expressed X linked protein 4 homolog antibody
    • Brain expressed X-linked 4 antibody
    • FLJ10097 antibody
    • NADE3 antibody
    • Nerve growth factor receptor associated protein 3 antibody
    • Protein BEX4 antibody
    see all

Images

  • Anti-BEX4 antibody - N-terminal (ab136317) at 1 µg/ml + HCT15 cell lysate at 10 µg

    Secondary
    standard HRP-labelled anti-rabbit

    Predicted band size: 14 kDa

References

ab136317 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab136317.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up