Overview

  • Product name

    Anti-BEX4 antibody - N-terminal
  • Description

    Rabbit polyclonal to BEX4 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Horse
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 28-77 (

    PTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRHIEHNEAR

    ) of Human BEX4 (NM_001127688).

  • Positive control

    • HCT15 cell lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab136317 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 14 kDa.

Target

  • Relevance

    Bex proteins are expressed from a family of "brain expressed X-linked genes".
  • Cellular localization

    Cytoplasmic and Nuclear
  • Database links

  • Alternative names

    • BEX family member 4 antibody
    • BEX1 like 1 antibody
    • BEX1 like protein 1 antibody
    • BEXL1 antibody
    • brain expressed gene 4 antibody
    • Brain expressed X linked like 1 antibody
    • Brain expressed X linked protein 4 antibody
    • Brain expressed X linked protein 4 homolog antibody
    • Brain expressed X-linked 4 antibody
    • FLJ10097 antibody
    • NADE3 antibody
    • Nerve growth factor receptor associated protein 3 antibody
    • Protein BEX4 antibody
    see all

Images

  • Anti-BEX4 antibody - N-terminal (ab136317) at 1 µg/ml + HCT15 cell lysate at 10 µg

    Secondary
    standard HRP-labelled anti-rabbit

    Predicted band size: 14 kDa

References

ab136317 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab136317.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up