Overview

  • Product name

  • Description

    Rabbit polyclonal to BGT-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human BGT-1 aa 515-614.
    Sequence:

    FSLSKYTPLKYNNVYVYPPWGYSIGWFLALSSMVCVPLFVVITLLKTRGP FRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSPTREGLIAGEKETHL


    Database link: P48065

  • Positive control

    • IHC-P: Human liver and kidney tissue.
  • General notes

    Previously labelled as SLC6A12.

Properties

Applications

Our Abpromise guarantee covers the use of ab230173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Transports betaine and GABA. May have a role in regulation of GABAergic transmission in the brain through the reuptake of GABA into presynaptic terminals, as well as in osmotic regulation.
  • Tissue specificity

    Liver, heart, skeletal muscle, placenta, and a widespread distribution in the brain.
  • Sequence similarities

    Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A12 subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Betaine/GABA transporter 1 antibody
    • BGT-1 antibody
    • BGT1 antibody
    • Gamma aminobutyric acid transporter antibody
    • GAT2 antibody
    • Na(+)/Cl(-) betaine/GABA transporter antibody
    • S6A12_HUMAN antibody
    • Slc6a12 antibody
    • Sodium- and chloride-dependent betaine transporter antibody
    • Solute carrier family 6 (neurotransmitter transporter), member 12 antibody
    • Solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12 antibody
    • Solute carrier family 6 member 12 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for BGT-1 with ab230173 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for BGT-1 with ab230173 at 1/100 dilution in immunohistochemical analysis.

References

ab230173 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230173.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up