Overview

  • Product name

  • Description

    Rabbit polyclonal to BICD2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human BICD2 aa 511-625.
    Sequence:

    DVAGETQGSLSVAQDELVTFSEELANLYHHVCMCNNETPNRVMLDYYREG QGGAGRTSPGGRTSPEARGRRSPILLPKGLLAPEAGRADGGTGDSSPSPG SSLPSPLSDPRREPM


    Database link: Q8TD16

  • Positive control

    • WB: HeLa, K562, HL-60 and A549 whole cell lysate. IHC-P: Human cervical cancer tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237616 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000.
WB 1/500 - 1/5000. Predicted molecular weight: 94 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    May play a role in the dynein-dynactin interactions on the surface of membranous organelles, by associating with these complexes. Regulates coat complex coatomer protein I (COPI)-independent Golgi-endoplasmic reticulum transport by recruiting the dynein-dynactin motor complex.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the BicD family.
  • Domain

    The fourth coiled coil region is involved in Golgi targeting and in the interaction with DCTN2.
  • Post-translational
    modifications

    Phosphorylated by NEK9 in vitro.
  • Cellular localization

    Golgi apparatus. Cytoplasm > cytoskeleton. In interphase cells mainly localizes to the Golgi complex and colocalizes with dynactin at microtubule plus ends (By similarity). Its localization is dependent on microtubule morphology.
  • Information by UniProt
  • Database links

  • Alternative names

    • bA526D8.1 antibody
    • Bic D 2 antibody
    • Bic-D 2 antibody
    • Bicaudal D homolog 2 (Drosophila) antibody
    • Bicaudal D homolog 2 antibody
    • Bicd2 antibody
    • BICD2_HUMAN antibody
    • Coiled coil protein BICD2 antibody
    • Cytoskeleton like bicaudal D protein homolog 2 antibody
    • Homolog of Drosophila bicaudal D antibody
    • KIAA0699 antibody
    • Protein bicaudal D homolog 2 antibody
    see all

Images

  • All lanes : Anti-BICD2 antibody (ab237616) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 3 : HL-60 (human promyelocytic leukemia cell line) whole cell lysate
    Lane 4 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 94 kDa

  • Paraffin-embedded cervical cancer tissue stained for BICD2 using ab237616 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for BICD2 (green) using ab237616 at 1/166 dilution in ICC/IF, followed by Alexa Fluor 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C. The nuclear counter stain is DAPI.

References

ab237616 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237616.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up