Overview

  • Product name

  • Description

    Rabbit polyclonal to BIG-2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human BIG-2 aa 731-980. (Expressed in E.coli).
    Sequence:

    RGFGYVVAFRPYGKMIWMLTVLASADASRYVFRNESVHPFSPFEVKVGVF NNKGEGPFSPTTVVYSAEEEPTKPPASIFARSLSATDIEVFWASPLEKNR GRIQGYEVKYWRHEDKEENARKIRTVGNQTSTKITNLKGSVLYHLAVKAY NSAGTGPSSATVNVTTRKPPPSQPPGNIIWNSSDSKIILNWDQVKALDNE SEVKGYKVLYRWNRQSSTSVIETNKTSVELSLPFDEDYIIEIKPFSDGGD


    Database link: Q8IWV2

  • Positive control

    • WB: Recombinant human BIG-2 protein; HeLa cell lysate; Pig brain lysate. IHC-P: Human prostate and breast cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab232782 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 113 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Contactins mediate cell surface interactions during nervous system development. Has some neurite outgrowth-promoting activity. May be involved in synaptogenesis.
  • Tissue specificity

    Mainly expressed in brain. Highly expressed in cerebellum and weakly expressed in corpus callosum, caudate nucleus, amygdala and spinal cord. Also expressed in testis, pancreas, thyroid, uterus, small intestine and kidney. Not expressed in skeletal muscle. Isoform 2 is weakly expressed in cerebral cortex.
  • Involvement in disease

    A chromosomal aberration involving CNTN4 has been found in a boy with characteristic physical features of 3p deletion syndrome (3PDS). Translocation t(3;10)(p26;q26). 3PDS is a rare contiguous gene disorder involving the loss of the telomeric portion of the short arm of chromosome 3 and characterized by developmental delay, growth retardation, and dysmorphic features.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. Contactin family.
    Contains 4 fibronectin type-III domains.
    Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Cell membrane. Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • AXCAM antibody
    • Axonal associated cell adhesion molecule antibody
    • BIG 2 antibody
    • BIG-2 antibody
    • Brain derived immunoglobulin superfamily protein 2 antibody
    • Brain-derived immunoglobulin superfamily protein 2 antibody
    • Cntn4 antibody
    • CNTN4_HUMAN antibody
    • CNTN4A antibody
    • contactin 4 antibody
    • Contactin-4 antibody
    • Neural cell adhesion protein BIG 2 antibody
    • SCA16 antibody
    see all

Images

  • All lanes : Anti-BIG-2 antibody (ab232782) at 3 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : Pig brain lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 113 kDa

  • Anti-BIG-2 antibody (ab232782) at 2 µg/ml + Recombinant human BIG-2 protein.

    Predicted band size: 113 kDa

  • Paraffin-embedded human breast cancer tissue stained for BIG-2 using ab232782 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate tissue stained for BIG-2 using ab232782 at 20 µg/ml in immunohistochemical analysis. DAB staining.

References

ab232782 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232782.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up