Overview

  • Product name

  • Description

    Rabbit polyclonal to Biglycan
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Sheep, Horse, Cow, Dog
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Biglycan aa 230-366. Expressed in E.coli. N-terminal tag.
    Sequence:

    TLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTL RELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKR AYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNY


    Database link: P21810

  • Positive control

    • IHC-P: Human breast cancer, liver, prostate, cerebrum and kidney tissues. WB: Pig kidney and spleen lysates; Recombinant human Biglycan protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231297 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 42 kDa.

Target

Images

  • Paraffin-embedded human breast cancer tissue stained for Biglycan using ab231297 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-Biglycan antibody (ab231297) at 5 µg/ml

    Lane 1 : Pig spleen lysate
    Lane 2 : Pig kidney lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit antibody at 1/1000 dilution

    Predicted band size: 42 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for Biglycan using ab231297 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate tissue stained for Biglycan using ab231297 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human cerebrum tissue stained for Biglycan using ab231297 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for Biglycan using ab231297 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Biglycan antibody (ab231297) at 2 µg/ml + Pig kidney lysate

    Predicted band size: 42 kDa

  • Anti-Biglycan antibody (ab231297) at 2 µg/ml + Pig spleen lysate

    Predicted band size: 42 kDa

  • Anti-Biglycan antibody (ab231297) at 2 µg/ml + Recombinant human Biglycan protein

    Predicted band size: 42 kDa

References

ab231297 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231297.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up