Anti-BIII antibody (ab223758)
Key features and details
- Rabbit polyclonal to BIII
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-BIII antibody
See all BIII primary antibodies -
Description
Rabbit polyclonal to BIII -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Rabbit -
Immunogen
Recombinant fragment corresponding to Human BIII aa 1857-1950.
Sequence:ALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLR GARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHE
Database link: Q00975 -
Positive control
- IHC-P: Human cerebral cortex tissue.
-
General notes
Previously labelled as CACNA1B (N type).
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab223758 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
Voltage-sensitive calcium channels (VSCCs) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. -
Cellular localization
Membrane; Multi-pass membrane protein. -
Database links
- Entrez Gene: 774 Human
- Entrez Gene: 12287 Mouse
- Entrez Gene: 100008979 Rabbit
- Entrez Gene: 257648 Rat
- Omim: 601012 Human
- SwissProt: Q00975 Human
- SwissProt: O55017 Mouse
- SwissProt: Q05152 Rabbit
see all -
Alternative names
- BIII antibody
- Brain calcium channel III antibody
- CACH5 antibody
see all
Images
Datasheets and documents
References (0)
ab223758 has not yet been referenced specifically in any publications.