Overview

  • Product name

    Anti-BinCARD antibody
  • Description

    Rabbit polyclonal to BinCARD
  • Host species

    Rabbit
  • Specificity

    ab201093 detects endogenous levels of BinCARD protein.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Synthetic peptide corresponding to Human BinCARD aa 34-79.
    Sequence:

    QLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQE


    Database link: Q96LW7-2

  • Positive control

    • Hela and H9C2 whole cell lysates.
  • General notes

    Previously labelled as C9orf89.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab201093 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity of is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab201093 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 21 kDa.

Target

  • Function

    Plays a role in inhibiting the effects of BCL10-induced activation of NF-kappa-B. May inhibit the phosphorylation of BCL10 in a CARD-dependent manner.
  • Tissue specificity

    Expressed in ovary, testis, placenta, skeletal muscle, kidney, lung, heart and liver (at protein level). Expressed in thymus and brain.
  • Sequence similarities

    Contains 1 CARD domain.
  • Cellular localization

    Endoplasmic reticulum membrane. Mitochondrion membrane and Nucleus. Coexpression with BCL10 induced translocation from nucleus to cytosol.
  • Information by UniProt
  • Database links

  • Alternative names

    • Bcl10 interacting protein with CARD protein antibody
    • Bcl10-interacting CARD protein antibody
    • BINCA_HUMAN antibody
    • BinCARD antibody
    • C9orf89 antibody
    • Chromosome 9 open reading frame 89 antibody
    see all

Images

  • All lanes : Anti-BinCARD antibody (ab201093)

    Lane 1 : Hela whole cell lysate
    Lane 2 : H9C2 whole cell lysate

    Predicted band size: 21 kDa

References

ab201093 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201093.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up