Biotin Anti-14-3-3 eta/YWHAH antibody (ab193177)
Key features and details
- Biotin Rabbit polyclonal to 14-3-3 eta/YWHAH
- Suitable for: IHC-P
- Reacts with: Human
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-14-3-3 eta/YWHAH antibody
See all 14-3-3 eta/YWHAH primary antibodies -
Description
Biotin Rabbit polyclonal to 14-3-3 eta/YWHAH -
Host species
Rabbit -
Conjugation
Biotin -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow
-
Immunogen
Recombinant fragment corresponding to Human 14-3-3 eta/YWHAH aa 4-246.
Sequence:REQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVV GARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSL LDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAA YKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDD AIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
Database link: Q04917 -
Positive control
- IHC-P: Human brain tissue.
-
General notes
This product was previously labelled as 14-3-3 eta
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), 49% PBS, 0.03% Proclin 300 -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
>95% -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab193177 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/20 - 1/200. |
Target
-
Function
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. -
Tissue specificity
Expressed mainly in the brain and present in other tissues albeit at lower levels. -
Sequence similarities
Belongs to the 14-3-3 family. - Information by UniProt
-
Database links
- Entrez Gene: 282126 Cow
- Entrez Gene: 7533 Human
- Entrez Gene: 22629 Mouse
- Entrez Gene: 25576 Rat
- Omim: 113508 Human
- SwissProt: P68509 Cow
- SwissProt: Q04917 Human
- SwissProt: P68510 Mouse
see all -
Alternative names
- 14 3 3 protein eta antibody
- 14-3-3 eta antibody
- 14-3-3 protein eta antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Biotin Anti-14-3-3 eta/YWHAH antibody (ab193177)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human brain tissue sections labeling 14-3-3 eta/YWHAH with ab193177 at dilution of 1/100.
Protocols
References (0)
ab193177 has not yet been referenced specifically in any publications.
