Biotin Anti-Amphiregulin antibody (ab246313)
Key features and details
- Biotin Rabbit polyclonal to Amphiregulin
- Suitable for: WB, Sandwich ELISA
- Reacts with: Recombinant fragment
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-Amphiregulin antibody
See all Amphiregulin primary antibodies -
Description
Biotin Rabbit polyclonal to Amphiregulin -
Host species
Rabbit -
Conjugation
Biotin -
Tested applications
Suitable for: WB, Sandwich ELISAmore details -
Species reactivity
Reacts with: Recombinant fragment
Predicted to work with: Human
-
Immunogen
Recombinant fragment corresponding to Human Amphiregulin aa 101-198. Produced in E.coli.
Sequence:SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEF QNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK
Database link: P15514 -
Positive control
- WB: Recombinant human Amphiregulin protein. sELISA: Recombinant human Amphiregulin protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:Reconstitute in sterile PBS + 0.1% BSA to 0.1 - 1.0 mg/mL. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark. -
Storage buffer
Constituent: PBS -
Concentration information loading... -
Purity
Affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab246313 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.1 - 0.2 µg/ml. | |
| Sandwich ELISA | Use a concentration of 0.25 - 1 µg/ml. |
Target
-
Function
Bifunctional growth-modulating glycoprotein. Inhibits growth of several human carcinoma cells in culture and stimulates proliferation of human fibroblasts and certain other tumor cells. -
Sequence similarities
Belongs to the amphiregulin family.
Contains 1 EGF-like domain. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 374 Human
- Entrez Gene: 727738 Human
- Omim: 104640 Human
- SwissProt: P15514 Human
- Unigene: 270833 Human
- Unigene: 645475 Human
-
Alternative names
- A REG antibody
- Amphiregulin antibody
- Amphiregulin B antibody
see all
Images
-
Western blot - Biotin Anti-Amphiregulin antibody (ab246313)
To detect human Amphiregulin by Western Blot analysis, ab246313 can be used at a concentration of 0.1-0.2 μg/ml. When used in conjunction with compatible development reagents, the detection limit for recombinant human Amphiregulin is 1.5-3.0 ng/lane, under either reducing or non-reducing conditions.
Lanes 1-11: 250, 125, 62.5, 31.25, 15.625, 7.8, 3.9, 1.95, 0.975, 0.4875 and 0.24 ng recombinant human Amphiregulin, respectively.
Non-reducing conditions.
-
Sandwich ELISA - Biotin Anti-Amphiregulin antibody (ab246313)To detect human Amphiregulin by sandwich ELISA (using 100μl/well), a concentration of 0.25-1.0 μg/ml of ab246313 is required. This biotinylated polyclonal antibody, in conjunction with a capture antibody, allows the detection of at least 2000-4000 pg/ml of recombinant human Amphiregulin.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab246313 has not yet been referenced specifically in any publications.
