Biotin Anti-BDNF antibody (ab245864)
Key features and details
- Biotin Rabbit polyclonal to BDNF
- Suitable for: WB, Sandwich ELISA
- Reacts with: Recombinant fragment
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-BDNF antibody
See all BDNF primary antibodies -
Description
Biotin Rabbit polyclonal to BDNF -
Host species
Rabbit -
Conjugation
Biotin -
Tested applications
Suitable for: WB, Sandwich ELISAmore details -
Species reactivity
Reacts with: Recombinant fragment
Predicted to work with: Mouse, Rat, Horse, Cow, Cat, Dog, Human, Pig, Chimpanzee, Rhesus monkey
-
Immunogen
Recombinant full length protein corresponding to Human BDNF aa 129-247. Full-length mature chainlacking the signal peptide and propeptide. Produced in E.coli.
Sequence:MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQL KQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIG WRFIRIDTSCVCTLTIKRGR
Database link: P23560 -
Positive control
- WB: Recombinant human BDNF protein. sELISA: Recombinant human BDNF protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:Reconstitute in sterile PBS + 0.1% BSA to 0.1-1.0mg/ml. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark. -
Storage buffer
Constituent: PBS -
Concentration information loading... -
Purity
Affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab245864 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 27 kDa. | |
| Sandwich ELISA | Use a concentration of 0.25 - 1 µg/ml. |
Target
-
Function
During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. -
Tissue specificity
Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta. -
Involvement in disease
Bulimia nervosa 2
Congenital central hypoventilation syndrome -
Sequence similarities
Belongs to the NGF-beta family. -
Post-translational
modificationsThe propeptide is N-glycosylated and glycosulfated.
Converted into mature BDNF by plasmin (PLG). -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 493690 Cat
- Entrez Gene: 503511 Chimpanzee
- Entrez Gene: 617701 Cow
- Entrez Gene: 403461 Dog
- Entrez Gene: 100009689 Horse
- Entrez Gene: 627 Human
- Entrez Gene: 12064 Mouse
- Entrez Gene: 397495 Pig
see all -
Alternative names
- Abrineurin antibody
- ANON2 antibody
- BDNF antibody
see all
Images
-
Western blot - Biotin Anti-BDNF antibody (ab245864)
To detect human BDNF by Western Blot analysis ab245864 can be used at a concentration of 0.1 - 0.2 µg/ml.
Used in conjunction with compatible secondary reagents the detection limit for recombinant human BDNF is 1.5 - 3.0 ng/lane, under either reducing or non-reducing conditions.
Lanes 1-11: 250, 125, 62.5, 31.25, 15.625, 7.8, 3.9, 1.95, 0.975, 0.4875 and 0.24 ng recombinant human BDNF, respectively.
Non-reducing conditions.
-
Sandwich ELISA - Biotin Anti-BDNF antibody (ab245864)To detect humanBDNF by sandwich ELISA (using 100 μl/well antibody solution) a concentration of 0.25 – 1.0 μg/ml of ab245864 is required.
This biotinylated polyclonal antibody, in conjunction with a capture antibody, allows the detection of at least 0.2 – 0.4 ng/well of recombinant human BDNF.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab245864 has not yet been referenced specifically in any publications.
