For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    biotin-bdnf-antibody-ab245864.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurology process Growth and Development Neurotrophins
Share by email

Biotin Anti-BDNF antibody (ab245864)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Biotin Anti-BDNF antibody (ab245864)
  • Sandwich ELISA - Biotin Anti-BDNF antibody (ab245864)

Key features and details

  • Biotin Rabbit polyclonal to BDNF
  • Suitable for: WB, Sandwich ELISA
  • Reacts with: Recombinant fragment
  • Conjugation: Biotin
  • Isotype: IgG

You may also be interested in

Peptide
Human BDNF peptide (ab182199)
ELISA
Product image
Human BDNF ELISA Kit (ab212166)
Primary
Product image
Anti-BDNF antibody [EPR1292] - Low endotoxin, Azide free (ab216443)

View more associated products

Overview

  • Product name

    Biotin Anti-BDNF antibody
    See all BDNF primary antibodies
  • Description

    Biotin Rabbit polyclonal to BDNF
  • Host species

    Rabbit
  • Conjugation

    Biotin
  • Tested applications

    Suitable for: WB, Sandwich ELISAmore details
  • Species reactivity

    Reacts with: Recombinant fragment
    Predicted to work with: Mouse, Rat, Horse, Cow, Cat, Dog, Human, Pig, Chimpanzee, Rhesus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human BDNF aa 129-247. Full-length mature chainlacking the signal peptide and propeptide. Produced in E.coli.
    Sequence:

    MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQL KQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIG WRFIRIDTSCVCTLTIKRGR


    Database link: P23560
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: Recombinant human BDNF protein. sELISA: Recombinant human BDNF protein.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Lyophilized:Reconstitute in sterile PBS + 0.1% BSA to 0.1-1.0mg/ml.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Storage buffer

    Constituent: PBS
  • Concentration information loading...
  • Purity

    Affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Neuroscience
    • Neurology process
    • Growth and Development
    • Neurotrophins
    • Neuroscience
    • Neurology process
    • Neurodegenerative disease
    • Huntington's disease
    • Neuroscience
    • Neurology process
    • Neurodegenerative disease
    • Alzheimer's disease
    • Other
    • Cardiovascular
    • Atherosclerosis
    • Diabetes associated
    • Cardiovascular
    • Atherosclerosis
    • Thrombosis
    • Other
    • Metabolism
    • Types of disease
    • Diabetes
    • Metabolism
    • Types of disease
    • Obesity

Associated products

  • Recombinant Protein

    • Recombinant Human/Murine/Rat BDNF protein (Active) (ab9794)
  • Related Products

    • Recombinant human BDNF protein (Animal Free) (ab217473)
    • Recombinant human BDNF protein (Animal Free) (ab222178)
    • Recombinant Human/Murine/Rat BDNF protein (Active) (ab9794)

Applications

Our Abpromise guarantee covers the use of ab245864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 27 kDa.
Sandwich ELISA Use a concentration of 0.25 - 1 µg/ml.

Target

  • Function

    During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.
  • Tissue specificity

    Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.
  • Involvement in disease

    Bulimia nervosa 2
    Congenital central hypoventilation syndrome
  • Sequence similarities

    Belongs to the NGF-beta family.
  • Post-translational
    modifications

    The propeptide is N-glycosylated and glycosulfated.
    Converted into mature BDNF by plasmin (PLG).
  • Cellular localization

    Secreted.
  • Target information above from: UniProt accession P23560 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 493690 Cat
    • Entrez Gene: 503511 Chimpanzee
    • Entrez Gene: 617701 Cow
    • Entrez Gene: 403461 Dog
    • Entrez Gene: 100009689 Horse
    • Entrez Gene: 627 Human
    • Entrez Gene: 12064 Mouse
    • Entrez Gene: 397495 Pig
    • Entrez Gene: 24225 Rat
    • Omim: 113505 Human
    • SwissProt: Q9TST3 Cat
    • SwissProt: Q5IS78 Chimpanzee
    • SwissProt: Q95106 Cow
    • SwissProt: Q7YRB4 Dog
    • SwissProt: Q0EAB7 Horse
    • SwissProt: P23560 Human
    • SwissProt: P21237 Mouse
    • SwissProt: P14082 Pig
    • SwissProt: P23363 Rat
    • SwissProt: P14082 Rhesus monkey
    • SwissProt: Q06225 Rhesus monkey
    • Unigene: 502182 Human
    • Unigene: 1442 Mouse
    • Unigene: 11266 Rat
    see all
  • Alternative names

    • Abrineurin antibody
    • ANON2 antibody
    • BDNF antibody
    • BDNF_HUMAN antibody
    • Brain Derived Neurotrophic Factor antibody
    • Brain-derived neurotrophic factor antibody
    • BULN2 antibody
    • MGC34632 antibody
    • Neurotrophin antibody
    see all

Images

  • Western blot - Biotin Anti-BDNF antibody (ab245864)
    Western blot - Biotin Anti-BDNF antibody (ab245864)

    To detect human BDNF by Western Blot analysis ab245864 can be used at a concentration of 0.1 - 0.2 µg/ml.

    Used in conjunction with compatible secondary reagents the detection limit for recombinant human BDNF is 1.5 - 3.0 ng/lane, under either reducing or non-reducing conditions.

    Lanes 1-11: 250, 125, 62.5, 31.25, 15.625, 7.8, 3.9, 1.95, 0.975, 0.4875 and 0.24 ng recombinant human BDNF, respectively.

    Non-reducing conditions.

  • Sandwich ELISA - Biotin Anti-BDNF antibody (ab245864)
    Sandwich ELISA - Biotin Anti-BDNF antibody (ab245864)

    To detect humanBDNF by sandwich ELISA (using 100 μl/well antibody solution) a concentration of 0.25 – 1.0 μg/ml of ab245864 is required.

    This biotinylated polyclonal antibody, in conjunction with a capture antibody, allows the detection of at least 0.2 – 0.4 ng/well of recombinant human BDNF.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab245864? Please let us know so that we can cite the reference in this datasheet.

    ab245864 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab245864.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.