Biotin Anti-C5 antibody (ab193113)
Key features and details
- Biotin Rabbit polyclonal to C5
- Reacts with: Pig
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-C5 antibody
See all C5 primary antibodies -
Description
Biotin Rabbit polyclonal to C5 -
Host species
Rabbit -
Conjugation
Biotin -
Species reactivity
Reacts with: Pig -
Immunogen
Recombinant full length protein corresponding to Pig C5 aa 1-74.
Sequence:MLQKKIEEEAAKYKYAMLKKCCYDGAYRNDDETCEERAARIKIGPKCVKA FKDCCYIANQVRAEQSHKNIQLGR
Database link: P01032 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), 49% PBS, 0.03% Proclin 300 -
Concentration information loading... -
Purity
Caprylic Acid - Ammonium Sulfate precipitation -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
Target
-
Function
Activation of C5 by a C5 convertase initiates the spontaneous assembly of the late complement components, C5-C9, into the membrane attack complex. C5b has a transient binding site for C6. The C5b-C6 complex is the foundation upon which the lytic complex is assembled.
Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. C5a also stimulates the locomotion of polymorphonuclear leukocytes (chemokinesis) and direct their migration toward sites of inflammation (chemotaxis). -
Involvement in disease
Defects in C5 are the cause of complement component 5 deficiency (C5D) [MIM:609536]. A rare defect of the complement classical pathway associated with susceptibility to severe recurrent infections, predominantly by Neisseria gonorrhoeae or Neisseria meningitidis.
Note=An association study of C5 haplotypes and genotypes in individuals with chronic hepatitis C virus infection shows that individuals homozygous for the C5_1 haplotype have a significantly higher stage of liver fibrosis than individuals carrying at least 1 other allele (PubMed:15995705). -
Sequence similarities
Contains 1 anaphylatoxin-like domain.
Contains 1 NTR domain. -
Cellular localization
Secreted. - Information by UniProt
-
Alternative names
- Anaphylatoxin C5a analog antibody
- C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4 antibody
- C5 antibody
see all
References (0)
ab193113 has not yet been referenced specifically in any publications.
