Biotin Anti-Carbonic Anhydrase 1/CA1 antibody (ab182891)
Key features and details
- Biotin Rabbit polyclonal to Carbonic Anhydrase 1/CA1
- Reacts with: Cow
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-Carbonic Anhydrase 1/CA1 antibody
See all Carbonic Anhydrase 1/CA1 primary antibodies -
Description
Biotin Rabbit polyclonal to Carbonic Anhydrase 1/CA1 -
Host species
Rabbit -
Conjugation
Biotin -
Species reactivity
Reacts with: Cow -
Immunogen
Full length native protein (purified) corresponding to Cow Carbonic Anhydrase 1/CA1 aa 2-261. Carbonic anhydrase from Bovine erythrocytes.
Sequence:ASPDWGYDGENGPEHWGKLYPIANGNNQSPIDIKTSETKRDPSLKPLSVS YNPATAKEIVNVGHSFHVNFEDSDNRSVLKGGPLSESYRLRQFHFHWGIT DDCGSEHLVDGAKFSAELHLVHWNSAKYPSFADAASQADGLALIGVLVKV GQANPNLQKVLDALKAVKNKNKKAPFTNFDPSVLLPPSLDYWAYSGSLTH PPLHESVTWIIFKETISVSSEQLAQFRSLLANAEGDREVHIKQNNRPPQP LNGRTVKASF
Database link: Q1LZA1 -
General notes
This product was previously labelled as Carbonic Anhydrase I
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:Add 1.0 ml sterile distilled water. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark. -
Storage buffer
pH: 7.20
Constituent: 100% PBS -
Concentration information loading...
-
Purity
IgG fraction -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
Target
-
Function
Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea. -
Sequence similarities
Belongs to the alpha-carbonic anhydrase family. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 510801 Cow
- SwissProt: Q1LZA1 Cow
-
Alternative names
- CA 1 antibody
- CA I antibody
- CA-I antibody
see all
Protocols
Datasheets and documents
References (0)
ab182891 has not yet been referenced specifically in any publications.