Biotin Anti-Carboxylesterase 1C antibody (ab193472)
Key features and details
- Biotin Rabbit polyclonal to Carboxylesterase 1C
- Suitable for: WB
- Reacts with: Mouse, Rat
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-Carboxylesterase 1C antibody
See all Carboxylesterase 1C primary antibodies -
Description
Biotin Rabbit polyclonal to Carboxylesterase 1C -
Host species
Rabbit -
Conjugation
Biotin -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Mouse Carboxylesterase 1C aa 19-550.
Sequence:HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPP QPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLY LNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTI QYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIF GESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIA TLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPK APEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLL LRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAV LLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLL KEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGA TTQQAQRLKAEEVAFWTELLAKNPPETDPTEH
Database link: P23953 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark. -
Storage buffer
pH: 7.40
Constituents: 49% PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
>95% -
Clonality
Polyclonal -
Isotype
IgG
Associated products
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab193472 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/50 - 1/2000. Predicted molecular weight: 62 kDa. |
Target
-
Function
Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant. -
Tissue specificity
Expressed in lung, kidney and liver. -
Sequence similarities
Belongs to the type-B carboxylesterase/lipase family. -
Cellular localization
Endoplasmic reticulum lumen. Microsomal membrane, lumen of endoplasmic reticulum. - Information by UniProt
-
Database links
- Entrez Gene: 13884 Mouse
- Entrez Gene: 24346 Rat
- SwissProt: P23953 Mouse
- SwissProt: P10959 Rat
- Unigene: 88078 Mouse
-
Alternative names
- Carboxylesterase 1C antibody
- Ces N antibody
- Ces1c antibody
see all
Images
-
All lanes : Biotin Anti-Carboxylesterase 1C antibody (ab193472) at 5 µg/ml
Lane 1 : Mouse liver tissue
Lane 2 : Rat lung tissue
Secondary
All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 62 kDa
Observed band size: 62 kDa
References (0)
ab193472 has not yet been referenced specifically in any publications.