Biotin Anti-Carboxypeptidase B/CPB antibody (ab191359)
Key features and details
- Biotin Rabbit polyclonal to Carboxypeptidase B/CPB
- Reacts with: Pig
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-Carboxypeptidase B/CPB antibody
See all Carboxypeptidase B/CPB primary antibodies -
Description
Biotin Rabbit polyclonal to Carboxypeptidase B/CPB -
Host species
Rabbit -
Conjugation
Biotin -
Species reactivity
Reacts with: Pig
Predicted to work with: Cow, Dog -
Immunogen
Full length native protein (purified) corresponding to Pig Carboxypeptidase B/CPB aa 111-416. (Derived from Porcine pancreas).
Sequence:TTGHSYEKYNNWETIEAWTKQVTSENPDLISRTAIGTTFLGNNIYLLKVG KPGPNKPAIFMDCGFHAREWISHAFCQWFVREAVLTYGYESHMTEFLNKL DFYVLPVLNIDGYIYTWTKNRMWRKTRSTNAGTTCIGTDPNRNFDAGWCT TGASTDPCDETYCGSAAESEKETKALADFIRNNLSSIKAYLTIHSYSQMI LYPYSYDYKLPENNAELNNLAKAAVKELATLYGTKYTYGPGATTIYPAAG GSDDWAYDQGIKYSFTFELRDKGRYGFILPESQIQATCEETMLAIKYVTN YVLGHL
Database link: P09955 -
General notes
This product was previously labelled as Carboxypeptidase B
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark. -
Storage buffer
Preservative: 0.01% Sodium azide
Constituents: 1% BSA, 0.42% Potassium phosphate, 0.87% Sodium chloride
BSA is Immunoglobulin and Protease free. -
Concentration information loading...
-
Purity
IgG fraction -
Purification notes
ab191359 is an IgG fraction antibody purified by a multi-step process including delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis against buffer. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
Applications
ELISA: 1/4000 - 1/20000.
This antibody has been assayed against 1.0µg of Carboxypeptidase B in a standard capture ELISA using Peroxidase conjugated streptavidin and ABTS (2,2'-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) as a substrate for 30 minutes at RT.
IM: Use at an assay dependent dilution.
WB: Use at an assay dependent dilution. Predicted molecular weight: 46 kDa.
Suitable for other antibody based assays using streptavidin or avidin conjugates.
Not yet tested in other applications.
Optimal dilutions/concentrations should be determined by the end user.
Target
-
Tissue specificity
Pancreas. -
Sequence similarities
Belongs to the peptidase M14 family. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 510039 Cow
- Entrez Gene: 403512 Dog
- Entrez Gene: 397341 Pig
- SwissProt: P00732 Cow
- SwissProt: P55261 Dog
- SwissProt: P09955 Pig
-
Alternative names
- Carboxypeptidase B antibody
- Carboxypeptidase B1 (tissue) antibody
- Carboxypeptidase B1 antibody
see all
Datasheets and documents
References (0)
ab191359 has not yet been referenced specifically in any publications.