For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    biotin-carboxypeptidase-bcpb-antibody-ab191359.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Metabolism Amino Acids
Share by email

Biotin Anti-Carboxypeptidase B/CPB antibody (ab191359)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Key features and details

  • Biotin Rabbit polyclonal to Carboxypeptidase B/CPB
  • Reacts with: Pig
  • Conjugation: Biotin
  • Isotype: IgG

You may also be interested in

Protein
Recombinant rat Carboxypeptidase B/CPB protein (ab129141)
Conjugation
Product image
Biotinylation Kit / Biotin Conjugation Kit (Fast, Type A) - Lightning-Link® (ab201795)

View more associated products

Overview

  • Product name

    Biotin Anti-Carboxypeptidase B/CPB antibody
    See all Carboxypeptidase B/CPB primary antibodies
  • Description

    Biotin Rabbit polyclonal to Carboxypeptidase B/CPB
  • Host species

    Rabbit
  • Conjugation

    Biotin
  • Species reactivity

    Reacts with: Pig
    Predicted to work with: Cow, Dog
  • Immunogen

    Full length native protein (purified) corresponding to Pig Carboxypeptidase B/CPB aa 111-416. (Derived from Porcine pancreas).
    Sequence:

    TTGHSYEKYNNWETIEAWTKQVTSENPDLISRTAIGTTFLGNNIYLLKVG KPGPNKPAIFMDCGFHAREWISHAFCQWFVREAVLTYGYESHMTEFLNKL DFYVLPVLNIDGYIYTWTKNRMWRKTRSTNAGTTCIGTDPNRNFDAGWCT TGASTDPCDETYCGSAAESEKETKALADFIRNNLSSIKAYLTIHSYSQMI LYPYSYDYKLPENNAELNNLAKAAVKELATLYGTKYTYGPGATTIYPAAG GSDDWAYDQGIKYSFTFELRDKGRYGFILPESQIQATCEETMLAIKYVTN YVLGHL


    Database link: P09955
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

     This product was previously labelled as Carboxypeptidase B

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Storage buffer

    Preservative: 0.01% Sodium azide
    Constituents: 1% BSA, 0.42% Potassium phosphate, 0.87% Sodium chloride

    BSA is Immunoglobulin and Protease free.
  • Concentration information loading...
  • Purity

    IgG fraction
  • Purification notes

    ab191359 is an IgG fraction antibody purified by a multi-step process including delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis against buffer.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Signal Transduction
    • Metabolism
    • Amino Acids
    • Metabolism
    • Pathways and Processes
    • Metabolic signaling pathways
    • Amino acid metabolism

Associated products

  • Isotype control

    • Biotin Rabbit IgG - Isotype Control (ab200208)
  • Recombinant Protein

    • Recombinant rat Carboxypeptidase B/CPB protein (ab129141)

Applications

  • Application notes
    Dot: Use at an assay dependent dilution.
    ELISA: 1/4000 - 1/20000.
    This antibody has been assayed against 1.0µg of Carboxypeptidase B in a standard capture ELISA using Peroxidase conjugated streptavidin and ABTS (2,2'-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) as a substrate for 30 minutes at RT.
    IM: Use at an assay dependent dilution.
    WB: Use at an assay dependent dilution. Predicted molecular weight: 46 kDa.
    Suitable for other antibody based assays using streptavidin or avidin conjugates.

    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • Tissue specificity

      Pancreas.
    • Sequence similarities

      Belongs to the peptidase M14 family.
    • Cellular localization

      Secreted.
    • Target information above from: UniProt accession P15086 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 510039 Cow
      • Entrez Gene: 403512 Dog
      • Entrez Gene: 397341 Pig
      • SwissProt: P00732 Cow
      • SwissProt: P55261 Dog
      • SwissProt: P09955 Pig
      • Alternative names

        • Carboxypeptidase B antibody
        • Carboxypeptidase B1 (tissue) antibody
        • Carboxypeptidase B1 antibody
        • CarboxypeptidaseB antibody
        • CarboxypeptidaseB1 antibody
        • CBPB1_HUMAN antibody
        • CP B1 antibody
        • CPB 1 antibody
        • CPB antibody
        • CPB1 antibody
        • DKFZp779K1333 antibody
        • Pancreas specific protein antibody
        • Pancreas-specific protein antibody
        • Pancreatic carboxypeptidase B antibody
        • Pancreatic carboxypeptidase B1 antibody
        • PASP antibody
        • PCPB antibody
        • Procarboxypeptidase B antibody
        • Procarboxypeptidase B pancreatic antibody
        • Protaminase antibody
        • Tissue carboxypeptidase B antibody
        see all

      Protocols

      • Western blot protocols

      Click here to view the general protocols

      Datasheets and documents

      • Datasheet
    • References (0)

      Publishing research using ab191359? Please let us know so that we can cite the reference in this datasheet.

      ab191359 has not yet been referenced specifically in any publications.

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      There are currently no Customer reviews or Questions for ab191359.
      Please use the links above to contact us or submit feedback about this product.

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.