Biotin Anti-CD137 antibody (ab245844)
Key features and details
- Biotin Goat polyclonal to CD137
- Suitable for: WB, Sandwich ELISA
- Reacts with: Recombinant fragment
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-CD137 antibody
See all CD137 primary antibodies -
Description
Biotin Goat polyclonal to CD137 -
Host species
Goat -
Conjugation
Biotin -
Tested applications
Suitable for: WB, Sandwich ELISAmore details -
Species reactivity
Reacts with: Recombinant fragment
Predicted to work with: Human -
Immunogen
Recombinant fragment corresponding to Human CD137 aa 19-184. Produced in E.coli.
Sequence:MERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQ CKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGC KNCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSP GASSVTPPAPAREPGHS
Database link: Q07011 -
Positive control
- WB: Recombinant human CD137 protein. sELISA: Recombinant human CD137 protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:Reconstitute in sterile PBS with 0.1% BSA to 0.1 - 1.0 mg/ml. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark. -
Storage buffer
Constituent: PBS -
Concentration information loading...
-
Purity
Affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab245844 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 28 kDa. | |
Sandwich ELISA | Use a concentration of 0.25 - 1 µg/ml. |
Target
-
Function
Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation. -
Tissue specificity
Expressed on the surface of activated T-cells. -
Sequence similarities
Contains 4 TNFR-Cys repeats. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 3604 Human
- Omim: 602250 Human
- SwissProt: Q07011 Human
- Unigene: 654459 Human
- Unigene: 86447 Human
-
Alternative names
- 4 1BB antibody
- 4 1BB ligand receptor antibody
- 4-1BB ligand receptor antibody
see all
Images
-
To detect human CD137 by Western Blot analysis ab245844 can be used at a concentration of 0.1 - 0.2 µg/ml.
Used in conjunction with compatible secondary reagents the detection limit for recombinant human CD137 is 1.5 - 3.0 ng/lane, under either reducing or non-reducing conditions.
Lanes 1-11: 250, 125, 62.5, 31.25, 15.625, 7.8, 3.9, 1.95, 0.975, 0.4875 and 0.24 ng recombinant human CD137, respectively.
Non-reducing conditions.
-
To detect human CD137 by sandwich ELISA (using 100 μl/well antibody solution) a concentration of 0.25 – 1.0 μg/ml of ab245844 is required.
This biotinylated polyclonal antibody, in conjunction with a capture antibody, allows the detection of at least 0.2 – 0.4 ng/well of recombinant human CD137.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab245844 has not yet been referenced specifically in any publications.