Biotin Anti-CXCL2 antibody (ab245861)
Key features and details
- Biotin Rabbit polyclonal to CXCL2
- Suitable for: WB, Sandwich ELISA
- Reacts with: Recombinant fragment
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-CXCL2 antibody
See all CXCL2 primary antibodies -
Description
Biotin Rabbit polyclonal to CXCL2 -
Host species
Rabbit -
Conjugation
Biotin -
Tested applications
Suitable for: WB, Sandwich ELISAmore details -
Species reactivity
Reacts with: Recombinant fragment
Predicted to work with: Rat
-
Immunogen
Recombinant fragment corresponding to Rat CXCL2 aa 28-100. Produced in E.coli.
Sequence:VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEV CLNPEAPLVQRIVQKILNKGKAN
Database link: P30348 -
Positive control
- WB: Recombinant rat CXCL2 protein. sELISA: Recombinant rat CXCL2 protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:Reconstitute in sterile PBS with 0.1% BSA to 0.1 - 1.0 mg/ml. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark. -
Storage buffer
Constituent: PBS -
Concentration information loading... -
Purity
Affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab245861 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 11 kDa. | |
| Sandwich ELISA | Use a concentration of 0.25 - 1 µg/ml. |
Target
-
Function
Produced by activated monocytes and neutrophils and expressed at sites of inflammation. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity. -
Sequence similarities
Belongs to the intercrine alpha (chemokine CxC) family. -
Post-translational
modificationsThe N-terminal processed form GRO-beta(5-73) is produced by proteolytic cleavage after secretion from bone marrow stromal cells. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 114105 Rat
- SwissProt: P30348 Rat
- Unigene: 10230 Rat
-
Alternative names
- C-X-C motif chemokine 2 antibody
- Chemokine (C X C motif) ligand 2 antibody
- Chemokine, CXC motif, ligand 2 antibody
see all
Images
-
Western blot - Biotin Anti-CXCL2 antibody (ab245861)
To detect rat CXCL2 by Western Blot analysis ab245861 can be used at a concentration of 0.1 - 0.2 µg/ml.
Used in conjunction with compatible secondary reagents the detection limit for recombinant rat CXCL2 is 1.5 - 3.0 ng/lane, under either reducing or non-reducing conditions.
Lane 1: Marker
Lanes 2-12: 250, 125, 62.5, 31.25, 15.625, 7.8, 3.9, 1.95, 0.975, 0.4875 and 0.24 ng recombinant rat CXCL2, respectively.
Reducing conditions.
-
Sandwich ELISA - Biotin Anti-CXCL2 antibody (ab245861)To detect rat CXCL2 by sandwich ELISA (using 100 μl/well antibody solution) a concentration of 0.25 – 1.0 μg/ml of ab245861 is required.
This biotinylated polyclonal antibody, in conjunction with a capture antibody, allows the detection of at least 0.2 – 0.4 ng/well of recombinant rat CXCL2.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab245861 has not yet been referenced specifically in any publications.
