Biotin Anti-Eotaxin antibody (ab245855)
Key features and details
- Biotin Goat polyclonal to Eotaxin
- Suitable for: Sandwich ELISA, WB
- Reacts with: Recombinant fragment
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-Eotaxin antibody
See all Eotaxin primary antibodies -
Description
Biotin Goat polyclonal to Eotaxin -
Host species
Goat -
Conjugation
Biotin -
Tested applications
Suitable for: Sandwich ELISA, WBmore details -
Species reactivity
Reacts with: Recombinant fragment
Predicted to work with: Human
-
Immunogen
Recombinant full length protein corresponding to Human Eotaxin aa 24-97. Produced in E. coli. Full length mature chain without signal peptide.
Sequence:GPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAVIFKTKLAKDIC ADPKKKWVQDSMKYLDQKSPTPKP
Database link: 51671 -
Positive control
- WB: Recombinant human Eotaxin protein. sELISA: Recombinant human Eotaxin protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Lyophilized:Reconstitute in sterile PBS + 0.1% BSA to 0.1-1.0mg/ml. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark. -
Storage buffer
Constituent: PBS -
Concentration information loading... -
Purity
Affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab245855 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| Sandwich ELISA | Use a concentration of 0.25 - 1 µg/ml. | |
| WB | Use a concentration of 0.1 - 0.2 µg/ml. Predicted molecular weight: 11 kDa. No endogenous data, tested with recombinant protein only. |
Target
-
Function
In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Binds to CCR3. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Post-translational
modificationsO-linked glycan consists of a Gal-GalNAc disaccharide which is mofified with up to 2 sialic acid residues. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 6356 Human
- Omim: 601156 Human
- SwissProt: P51671 Human
- Unigene: 54460 Human
-
Alternative names
- C-C motif chemokine 11 antibody
- CCL 11 antibody
- CCL11 antibody
see all
Images
-
Western blot - Biotin Anti-Eotaxin antibody (ab245855)
To detect human Eotaxin by Western Blot analysis this antibody can be used at a concentration of 0.1 - 0.2 µg/ml. Used in conjunction with compatible secondary reagents the detection limit for recombinant human Eotaxin is 1.5 - 3.0 ng/lane, under either reducing or non-reducing conditions.
Lane 1: Marker.
Lanes 2-12: 250, 125, 62.5, 31.25, 15.625, 7.8, 3.9, 1.95, 0.975, 0.4875 and 0.24 ng/ml respectively.
-
Sandwich ELISA - Biotin Anti-Eotaxin antibody (ab245855)To detect human Eotaxin by sandwich ELISA (using 100 μl/well antibody solution) a concentration of 0.25 – 1.0 μg/ml of this antibody is required.
This biotinylated polyclonal antibody, in conjunction with a capture antibody, allows the detection of at least 0.2 – 0.4 ng/well of recombinant human Eotaxin.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab245855 has not yet been referenced specifically in any publications.
