Biotin Anti-Flagellin antibody (ab193301)
Key features and details
- Biotin Rabbit polyclonal to Flagellin
- Suitable for: ELISA
- Reacts with: Escherichia coli
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-Flagellin antibody
See all Flagellin primary antibodies -
Description
Biotin Rabbit polyclonal to Flagellin -
Host species
Rabbit -
Conjugation
Biotin -
Tested applications
Suitable for: ELISAmore details -
Species reactivity
Reacts with: Escherichia coli -
Immunogen
Recombinant full length protein corresponding to Escherichia coli Flagellin aa 2-498.
Sequence:AQVINTNSLSLITQNNINKNQSALSSSIERLSSGLRINSAKDDAAGQAIA NRFTSNIKGLTQAARNANDGISVAQTTEGALSEINNNLQRVRELTVQATT GTNSESDLSSIQDEIKSRLDEIDRVSGQTQFNGVNVLAKNGSMKIQVGAN DNQTITIDLKQIDAKTLGLDGFSVKNNDTVTTSAPVTAFGATTTNNIKLT GITLSTEAATDTGGTNPASIEGVYTDNGNDYYAKITGGDNDGKYYAVTVA NDGTVTMATGATANATVTDANTTKATTITSGGTPVQIDNTAGSATANLGA VSLVKLQDSKGNDTDTYALKDTNGNLYAADVNETTGAVSVKTITYTDSSG AASSPTAVKLGGDDGKTEVVDIDGKTYDSADLNGGNLQTGLTAGGEALTA VANGKTTDPLKALDDAIASVDKFRSSLGAVQNRLDSAVTNLNNTTTNLSE AQSRIQDADYATEVSNMSKAQIIQQAGNSVLAKANQVPQQVLSLLQG
Database link: P04949 -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Store In the Dark. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), 49% PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Caprylic Acid - Ammonium Sulfate precipitation -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab193301 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ELISA | Use at an assay dependent concentration. |
Target
-
Relevance
Flagellin (FliC) is a subunit protein that polymerizes (along with other proteins) to form the filaments of bacterial flagella. Assembly of the bacterial flagellum occurs in a precise, temporal order where the basal component (FlgE, FlgK, and FlgL are assembled inside the bacterial membrane, followed by exportation of the filament cap protein FliD, and secretion of about 20,000 flagellin monomers (FliC) through the channel. FliC monomers are polymerized to form the tail filament. FliC monomers can function as pathogen-associated molecular patterns (PAMPs), and can be detected by host cells through surface-localized toll-like receptor 5 (TLR5) and cytosolic Nod-like receptors (NLRs). -
Cellular localization
Secreted. Bacterial flagellum. -
Database links
- Entrez Gene: 949101 Escherichia coli
- Entrez Gene: 961921 Escherichia coli
- SwissProt: P04949 Escherichia coli
-
Alternative names
- 41 kDa antigen antibody
- b1923 antibody
- flaF antibody
see all
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (1)
ab193301 has been referenced in 1 publication.
- Braathen R et al. The Magnitude and IgG Subclass of Antibodies Elicited by Targeted DNA Vaccines Are Influenced by Specificity for APC Surface Molecules. Immunohorizons 2:38-53 (2018). PubMed: 31022690