Biotin Anti-GLP1 antibody [8G9] (ab121085)
Key features and details
- Biotin Mouse monoclonal [8G9] to GLP1
- Reacts with: Rat
- Conjugation: Biotin
- Isotype: IgG1
Overview
-
Product name
Biotin Anti-GLP1 antibody [8G9]
See all GLP1 primary antibodies -
Description
Biotin Mouse monoclonal [8G9] to GLP1 -
Host species
Mouse -
Conjugation
Biotin -
Species reactivity
Reacts with: Rat
Predicted to work with: Mammals -
Immunogen
Synthetic peptide:
HAEGTFTSNVSSYLEGQAAKEFIAWLVKGR
, corresponding to amino acids 7-36 amide of GLP1, coupled to carrier and adsorbed onto aluminum hydroxide gel. -
Epitope
C-terminal epitope of GLP1(7-36)amide. -
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: 99% Phosphate Buffer, 0.82% Sodium chloride -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
8G9 -
Myeloma
x63-Ag8.653 -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Associated products
-
Alternative Versions
-
Isotype control
-
Recombinant Protein
Target
-
Function
Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes.
GLP-1 is a potent stimulator of glucose-dependent insulin release. Play important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Have growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion. Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferaton. Inhibits beta cell apoptosis.
GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability.
Oxyntomodulin significantly reduces food intake. Inhibits gastric emptying in humans. Suppression of gastric emptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fullness.
Glicentin may modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life. -
Tissue specificity
Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 are also secreted in selected neurons in the brain. -
Sequence similarities
Belongs to the glucagon family. -
Post-translational
modificationsProglucagon is post-translationally processed in a tissue-specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by post-translational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 24952 Rat
- SwissProt: P06883 Rat
- Unigene: 54383 Rat
-
Alternative names
- GCG antibody
- Glicentin related polypeptide antibody
- glicentin-related polypeptide antibody
see all
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab121085 has not yet been referenced specifically in any publications.