For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    biotin-gsta1-antibody-8-326-ab173835.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Metabolism Energy Metabolism
Share by email

Biotin Anti-GSTA1 antibody [8-326] (ab173835)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Biotin Anti-GSTA1 antibody [8-326] (ab173835)

    Key features and details

    • Biotin Mouse monoclonal [8-326] to GSTA1
    • Suitable for: WB
    • Reacts with: Human
    • Conjugation: Biotin
    • Isotype: IgG

    You may also be interested in

    Primary
    DyLight® 650 Anti-DDDDK tag (Binds to FLAG® tag sequence) antibody [M2] (ab117492)
    Primary
    Product image
    Anti-HA tag antibody [EPR4095] - BSA and Azide free (ab238998)
    Primary
    Product image
    Anti-GSTA1 antibody [EPR19969] - BSA and Azide free (ab251473)

    View more associated products

    Overview

    • Product name

      Biotin Anti-GSTA1 antibody [8-326]
      See all GSTA1 primary antibodies
    • Description

      Biotin Mouse monoclonal [8-326] to GSTA1
    • Host species

      Mouse
    • Conjugation

      Biotin
    • Tested Applications & Species

      Application Species
      WB
      Human
      See all applications and species data
    • Immunogen

      Recombinant full length protein corresponding to Human GSTA1 aa 1-222.
      Sequence:

      MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYL MFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIA DLGEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVLKSHGQDYLVG NKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQP GSPRKPPMDEKSLEEARKIFRF


      Database link: P08263
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • Purified Glutathione S Transferase-SRC SH2 domain
    • General notes

      Previously labelled as Glutathione S Transferase alpha 1. 

      The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

      One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

      Learn more here.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C.
    • Storage buffer

      Preservative: 0.02% Sodium azide
      Constituent: 99% PBS
    • Concentration information loading...
    • Purity

      Protein A purified
    • Clonality

      Monoclonal
    • Clone number

      8-326
    • Isotype

      IgG
    • Research areas

      • Signal Transduction
      • Metabolism
      • Energy Metabolism
      • Tags & Cell Markers
      • Fusion / Marker Proteins
      • GST
      • Metabolism
      • Pathways and Processes
      • Metabolic signaling pathways
      • Energy transfer pathways
      • Energy Metabolism
      • Metabolism
      • Pathways and Processes
      • Redox metabolism
      • Oxidative stress

    Associated products

    • Alternative Versions

      • HRP Anti-GSTA1 antibody [8-326] (ab173836)
    • Isotype control

      • Biotin Mouse IgG - Isotype Control (ab37358)
    • Recombinant Protein

      • Recombinant Human GSTA1 protein (ab95381)
    • Related Products

      • Recombinant human GSTA1 protein (ab167981)
      • Recombinant Human GSTA1 protein (ab95381)

    Applications

    The Abpromise guarantee

    Our Abpromise guarantee covers the use of ab173835 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Guaranteed

    Tested applications are guaranteed to work and covered by our Abpromise guarantee.

    Predicted

    Predicted to work for this combination of applications and species but not guaranteed.

    Incompatible

    Does not work for this combination of applications and species.

    Application Species
    WB
    Human
    Application Abreviews Notes
    WB
    1/500 - 1/1000. Predicted molecular weight: 26 kDa.
    Notes
    WB
    1/500 - 1/1000. Predicted molecular weight: 26 kDa.

    Target

    • Function

      Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
    • Tissue specificity

      Liver.
    • Sequence similarities

      Belongs to the GST superfamily. Alpha family.
      Contains 1 GST C-terminal domain.
      Contains 1 GST N-terminal domain.
    • Domain

      The C-terminal domain may form a component of the hydrophobic substrate-binding site, but in contrast appears not to be directly involved in GSH binding and is not absolutely essential for catalytic activity.
    • Cellular localization

      Cytoplasm.
    • Target information above from: UniProt accession P08263 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 2938 Human
      • Omim: 138359 Human
      • SwissProt: P08263 Human
      • Unigene: 446309 Human
      • Alternative names

        • Glutathione S alkyltransferase A1 antibody
        • Glutathione S aryltransferase A1 antibody
        • Glutathione S transferase 2 antibody
        • Glutathione S transferase A1 antibody
        • Glutathione S transferase alpha 1 antibody
        • Glutathione S transferase Ha subunit 1 antibody
        • Glutathione S-transferase A1 antibody
        • GST class-alpha member 1 antibody
        • GST epsilon antibody
        • GST HA subunit 1 antibody
        • GST, class alpha, 1 antibody
        • GST-epsilon antibody
        • GST2 antibody
        • GSTA1 1 antibody
        • GSTA1 antibody
        • GSTA1-1 antibody
        • GSTA1_HUMAN antibody
        • GTH1 antibody
        • HA subunit 1 antibody
        • MGC131939 antibody
        • OTTHUMP00000016611 antibody
        • S (hydroxyalkyl)glutathione lyase A1 antibody
        see all

      Images

      • Western blot - Biotin Anti-GSTA1 antibody [8-326] (ab173835)
        Western blot - Biotin Anti-GSTA1 antibody [8-326] (ab173835)
        All lanes : Biotin Anti-GSTA1 antibody [8-326] (ab173835) at 1/1000 dilution

        Lane 1 : Purified GSTA1 -SRC SH2 domain at 0.5 µg
        Lane 2 : Purified GSTA1 -SRC SH2 domain at 0.25 µg
        Lane 3 : Purified GSTA1-SRC SH2 domain at 0.125 µg
        Lane 4 : Purified GSTA1 -SRC SH2 domain at 0.06 µg
        Lane 5 : Purified GSTA1 -SRC SH2 domain at 0.03 µg

        Secondary
        All lanes : Streptavidin-HRP at 1/20000 dilution

        Developed using the ECL technique.

        Predicted band size: 26 kDa

      Protocols

      • Western blot protocols

      Click here to view the general protocols

      Datasheets and documents

      • SDS download

      • Datasheet download

        Download

      References (0)

      Publishing research using ab173835? Please let us know so that we can cite the reference in this datasheet.

      ab173835 has not yet been referenced specifically in any publications.

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      There are currently no Customer reviews or Questions for ab173835.
      Please use the links above to contact us or submit feedback about this product.

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.