Biotin Anti-GSTA1 antibody [8-326] (ab173835)
![Western blot - Biotin Anti-GSTA1 antibody [8-326] (ab173835)](https://www.abcam.com/ps/products/173/ab173835/Images/ab173835-197653-wb1.jpg "Western blot - Biotin Anti-GSTA1 antibody [8-326] (ab173835)")
Key features and details
- Biotin Mouse monoclonal [8-326] to GSTA1
- Suitable for: WB
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-GSTA1 antibody [8-326]
See all GSTA1 primary antibodies -
Description
Biotin Mouse monoclonal [8-326] to GSTA1 -
Host species
Mouse -
Conjugation
Biotin -
Tested applications
Suitable for: WBmore details -
Immunogen
Recombinant full length protein corresponding to Human GSTA1 aa 1-222.
Sequence:MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYL MFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIA DLGEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVLKSHGQDYLVG NKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQP GSPRKPPMDEKSLEEARKIFRF
Database link: P08263 -
Positive control
- Purified Glutathione S Transferase-SRC SH2 domain
-
General notes
Previously labelled as Glutathione S Transferase alpha 1.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
Preservative: 0.02% Sodium azide
Constituent: 99% PBS -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
8-326 -
Isotype
IgG -
Research areas
Associated products
-
Alternative Versions
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab173835 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/500 - 1/1000. Predicted molecular weight: 26 kDa. |
Target
-
Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. -
Tissue specificity
Liver. -
Sequence similarities
Belongs to the GST superfamily. Alpha family.
Contains 1 GST C-terminal domain.
Contains 1 GST N-terminal domain. -
Domain
The C-terminal domain may form a component of the hydrophobic substrate-binding site, but in contrast appears not to be directly involved in GSH binding and is not absolutely essential for catalytic activity. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Alternative names
- Glutathione S alkyltransferase A1 antibody
- Glutathione S aryltransferase A1 antibody
- Glutathione S transferase 2 antibody
see all
Images
-
Western blot - Biotin Anti-GSTA1 antibody [8-326] (ab173835)All lanes : Biotin Anti-GSTA1 antibody [8-326] (ab173835) at 1/1000 dilution
Lane 1 : Purified GSTA1 -SRC SH2 domain at 0.5 µg
Lane 2 : Purified GSTA1 -SRC SH2 domain at 0.25 µg
Lane 3 : Purified GSTA1-SRC SH2 domain at 0.125 µg
Lane 4 : Purified GSTA1 -SRC SH2 domain at 0.06 µg
Lane 5 : Purified GSTA1 -SRC SH2 domain at 0.03 µg
Secondary
All lanes : Streptavidin-HRP at 1/20000 dilution
Developed using the ECL technique.
Predicted band size: 26 kDa
Datasheets and documents
References (0)
ab173835 has not yet been referenced specifically in any publications.
