Biotin Anti-GSTA1 antibody [8-326] (ab173835)
Key features and details
- Biotin Mouse monoclonal [8-326] to GSTA1
- Suitable for: WB
- Reacts with: Human
- Conjugation: Biotin
- Isotype: IgG
Overview
-
Product name
Biotin Anti-GSTA1 antibody [8-326]
See all GSTA1 primary antibodies -
Description
Biotin Mouse monoclonal [8-326] to GSTA1 -
Host species
Mouse -
Conjugation
Biotin -
Tested Applications & Species
Application Species WB Human -
Immunogen
Recombinant full length protein corresponding to Human GSTA1 aa 1-222.
Sequence:MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYL MFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIA DLGEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVLKSHGQDYLVG NKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQP GSPRKPPMDEKSLEEARKIFRF
Database link: P08263 -
Positive control
- Purified Glutathione S Transferase-SRC SH2 domain
-
General notes
Previously labelled as Glutathione S Transferase alpha 1.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. -
Storage buffer
Preservative: 0.02% Sodium azide
Constituent: 99% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
8-326 -
Isotype
IgG -
Research areas
Associated products
-
Alternative Versions
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab173835 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Tested applications are guaranteed to work and covered by our Abpromise guarantee.
Predicted to work for this combination of applications and species but not guaranteed.
Does not work for this combination of applications and species.
Application | Species |
---|---|
WB |
Human
|
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/1000. Predicted molecular weight: 26 kDa.
|
Notes |
---|
WB
1/500 - 1/1000. Predicted molecular weight: 26 kDa. |
Target
-
Function
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. -
Tissue specificity
Liver. -
Sequence similarities
Belongs to the GST superfamily. Alpha family.
Contains 1 GST C-terminal domain.
Contains 1 GST N-terminal domain. -
Domain
The C-terminal domain may form a component of the hydrophobic substrate-binding site, but in contrast appears not to be directly involved in GSH binding and is not absolutely essential for catalytic activity. -
Cellular localization
Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 2938 Human
- Omim: 138359 Human
- SwissProt: P08263 Human
- Unigene: 446309 Human
-
Alternative names
- Glutathione S alkyltransferase A1 antibody
- Glutathione S aryltransferase A1 antibody
- Glutathione S transferase 2 antibody
see all
Images
-
All lanes : Biotin Anti-GSTA1 antibody [8-326] (ab173835) at 1/1000 dilution
Lane 1 : Purified GSTA1 -SRC SH2 domain at 0.5 µg
Lane 2 : Purified GSTA1 -SRC SH2 domain at 0.25 µg
Lane 3 : Purified GSTA1-SRC SH2 domain at 0.125 µg
Lane 4 : Purified GSTA1 -SRC SH2 domain at 0.06 µg
Lane 5 : Purified GSTA1 -SRC SH2 domain at 0.03 µg
Secondary
All lanes : Streptavidin-HRP at 1/20000 dilution
Developed using the ECL technique.
Predicted band size: 26 kDa
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab173835 has not yet been referenced specifically in any publications.